KEGG   Sinorhizobium fredii USDA 257: USDA257_c28440
Entry
USDA257_c28440    CDS       T02188                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    USDA257_c28440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfd02044]
    USDA257_c28440
Secretion system [BR:sfd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   USDA257_c28440
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C
Other DBs
NCBI-ProteinID: AFL51415
UniProt: I3X6A9
Position
2981696..2984002
AA seq 768 aa
MSEDRKTFVQTPLDPAKLTFTHLLGYDEISRCFAFTVGFVSPDENVDPLKLLGKPISVEG
ESGDPKRWFSGLVSDFRLIRIQEGLAYYEAEVRPWLWLLGNTTDCRIFQNMSVVEIAEEI
FSKYKPAKFEKRLQGSYEAREYCVQYDETDLDFVQRLFEHEGIMYFFEYGDGEHTLILAD
AMNRLKPAPGYATVKFRAEGEPIRRDQEYITEWVATSSVHPATYAHTDYDFTKPAADLMA
QSAQPFAHSQSRGEYYRHPGAHLTVGRGDSVAVVRREEIQAAHKRIAAAGTVRGLASGCT
FKLEDFPRKDQNAEYLVLRADYRLFDPGYRPAAYADEETFRANLKVAPTSLTYRPPRITP
RPIMRGPQTATVVGPKGEEIFTDKYARVKVQFHWDRLGKKDQNSSCFVRVSQTWAGAGWG
FIQIPRIGQEVIIDFLEGDPDRPIITGRVYNGKEMPPYELPGNATQSGLKTNSSPGGGGW
NELRFEDKAGSEEVYFQAQKDNNLLIKNDRSKLVQHDQSDRIDNNAKHSVGVNLDEDVGN
NKTTKVGVDRTVDIGSNDTETVGINRSLTVGADETISIGSNSTETIGSNHTQTVGIVQTV
TVGAARIDSVGASETRTVGASQTNTIGTNRSVSVGSSQSHDIGTSDSWEIGTDQSVQIGG
GQTSEIGKGRSAKIGEDDATQIGGARSIKVAKSSLVEIGQDGGVNVGKKLVIEAGEAITI
KTGSAMIVMKKDGTITIEGKDISVNAKGKFVGKASGEVSWKGSKINQN
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgtccgaagaccgcaagacattcgtccagacgccgctcgatcccgcgaagctgaccttc
acccatctgctcgggtatgacgaaatcagccgctgttttgccttcaccgtcgggtttgtc
agccccgacgagaatgtcgatccgctgaaactcctcggaaaaccaatctcggtcgaggga
gagtccggtgatccgaaacgctggttcagtgggcttgtttcggattttcgcctgatccgg
atacaggaagggcttgcatattacgaggcggaggtgcggccgtggctttggctgttgggc
aacacgaccgattgtcgcatctttcagaacatgagtgtcgtggaaatcgccgaggagatc
ttctcgaaatacaagcccgccaagttcgagaagcggttgcaaggttcctatgaggcgcgg
gaatactgcgttcagtatgacgagactgacctggacttcgtgcagcgcctattcgagcac
gaaggcatcatgtattttttcgagtatggcgacggtgagcacactctcatccttgccgac
gctatgaacaggctgaagcctgccccgggttatgcgacggtcaagttccgtgccgaaggc
gaaccgatccgacgggaccaggaatatatcacagagtgggtagcgaccagttccgtccac
ccggccacctatgcccacacggactacgatttcaccaagcccgccgccgacctgatggcg
caatcggcgcagccctttgcgcattcgcaatcacggggagagtattaccgtcatcccggt
gcccacctgactgtaggccgcggcgactccgttgccgtcgtaaggcgagaggaaattcag
gctgcgcacaaaaggatcgcggccgccggcactgtgcgtggactggcttcgggttgcacg
ttcaaactggaagacttcccccgcaaagaccaaaacgcggaatatctagtgcttcgcgcc
gactaccgcctttttgacccaggctaccgccccgccgcctatgcggacgaagagaccttc
cgcgcgaacttgaaggttgcgccgacttcgctgacttatcggccaccgcgtatcacgcct
cggccgatcatgcgtggtccgcaaacggcgacagtcgtgggccccaagggtgaggaaatc
ttcacggataaatacgctcgggtgaaggtgcagtttcactgggaccgtcttggcaagaaa
gaccagaacagttcctgcttcgtgcgggtctcgcagacctgggcgggcgcgggctggggg
ttcattcagatcccgcgtatcggccaggaggtgatcatcgacttccttgagggggacccg
gaccggccgattatcactggcagggtctataacggcaaggaaatgcctccctacgagcta
ccgggaaatgcaacccagtcagggctgaagacgaattcctcacctggtgggggaggctgg
aacgaactgcgctttgaggacaaggcgggatcggaggaagtctacttccaggcgcagaag
gacaacaacctgctgatcaagaacgaccgcagcaagctggtccagcacgaccagtcggac
cgtatcgacaacaatgccaagcattctgttggtgtgaacctcgatgaggacgtcggtaac
aacaagacgacgaaggtcggcgtcgaccgaacggtcgatatcggctccaacgataccgaa
accgttggaatcaaccgctcgcttacggtgggcgctgacgaaacgatcagcatcggctcg
aattccaccgagacgatcggctcaaatcacacccagacagttggcatcgtccaaacagtc
actgtgggggcggcacgcatcgactcagtcggggcctcagaaaccagaacggtaggggcc
tcacagacgaacaccatcggcacgaaccggtcagtgagcgtgggcagcagccaaagccat
gacatcggtacgtccgacagctgggaaatcggcaccgaccaaagcgttcagatcggcggc
ggacagacgagcgagatcggcaagggccgcagcgcgaaaatcggcgaggacgatgcaacg
cagatcggcggagcgagatcgataaaggtcgccaagagcagcctggtcgaaattggtcaa
gacggtggcgtgaacgtcgggaagaagctggtgatcgaggcaggcgaagcaattaccatc
aagactggctcagcaatgatcgtaatgaaaaaggacggcacgatcacgatcgaaggcaaa
gatatttctgtcaacgccaagggcaagtttgtcggcaaggcttcgggcgaggtcagttgg
aagggcagcaagatcaatcaaaattag

DBGET integrated database retrieval system