KEGG   Sinorhizobium fredii USDA 257: USDA257_c28530
Entry
USDA257_c28530    CDS       T02188                                 

Definition
(GenBank) putative conserved membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    USDA257_c28530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfd02044]
    USDA257_c28530
Secretion system [BR:sfd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   USDA257_c28530
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AFL51424
UniProt: I3X6B8
Position
complement(2993031..2994350)
AA seq 439 aa
MASEDPFGLSEDQGRTRIRPPPAAKRIVPTGPLVRRARCHPNTLINAFATLLEFAPELEN
ALPPGNPEALRTRLMEELVTARDAAVASGASLTRADAAAWAVASLLDDLALNTPWGGSSA
WPRQPLVVMLRGDVDAGAQFFARLEELERHPGRDRELLELHYFCLALGFRGKYRVPGRAG
DRSLSAVRAAAARFLRDPDGESAPLSPRWEGVMAADEPSRFAIPIWVLAVVAVVLATAIY
VPLSMRLGAKAEELATLVRALPPPERAEIYRPNKRTPAPDAPSVQAVVFELLPEFRAAAP
PALLSALKGNETASSVKLLLQSSNPELFQSARAELTKSFEPLVVSIAAVLRDNAELIGSV
TIVGHTDNVPLQATNPLSNNQRLSEARAATIAALLAANGVPTEHVRSEGRAATQPLARND
SREGRAANRRIELLIAKRL
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggcaagtgaggacccattcggcctttcggaagatcaaggccgtacgcgtatccgcccg
ccgccggccgccaagcggatcgttcccaccggcccgttagtgaggcgggcgcgatgccat
cccaacacgctgatcaatgctttcgctacgcttttggaatttgcgccggaactcgagaat
gcgctgccgcccggcaatccggaagcgctgagaacaaggctcatggaggagctggtaact
gcacgagatgcggccgttgcctccggggcaagccttacaagggcagacgcggccgcctgg
gctgtcgcttcgcttctcgatgatctggcgctcaacacaccatggggcggctccagtgcg
tggcctcgccagccgctcgtcgtcatgcttcgaggcgacgtggatgcgggtgcacagttc
ttcgcccggttggaagaacttgagcgccatcccggccgcgatcgtgaattgctggagctg
cactatttctgcctggcgctcggcttccggggcaaataccgcgtgccggggcgtgcaggt
gatcgctccctcagcgctgtgcgagctgcagctgcccgcttcctgcgggaccccgatggc
gagagtgcgccgctctcgcccaggtgggagggcgtcatggcagccgacgaaccttcccgc
tttgccattccgatctgggtgctcgcagtcgtggcggtggtgcttgcgaccgcgatttac
gtgccgctgtccatgcggctgggggccaaggcggaagaactagcaacgctcgttcgggca
ctgccgccgccggagcgggccgaaatctatcgcccgaacaagcgcacgccggcgccggat
gcgccatcggtccaagcggtcgttttcgagcttttgcccgaatttcgcgccgccgcgcct
cctgcccttctgtcagccctgaagggcaatgaaaccgcctcttctgtgaaactcctgctt
caatcgagcaatccggagctctttcagtctgcacgggccgaactgacgaaaagcttcgaa
ccgctcgtcgtctctattgcggctgttctcagggataatgctgaattgatcggaagtgtc
acgatcgtcggtcacaccgataatgttccactccaggccaccaatccgctttcaaacaat
caacgcctctccgaggcgcgcgctgctacgattgctgctttgctggcggccaacggcgtg
ccaactgaacacgtgcgatcggaaggacgtgcggcaacgcagcccctggccaggaacgat
agtcgagaaggtcgagccgccaatcgcaggatcgagctcttgatcgcaaagaggctctga

DBGET integrated database retrieval system