KEGG   Sinorhizobium fredii USDA 257: USDA257_c28600Help
Entry
USDA257_c28600    CDS       T02188                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    USDA257_c28600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfd02044]
    USDA257_c28600
Secretion system [BR:sfd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   USDA257_c28600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AFL51431
UniProt: I3X6C5
Position
complement(3001060..3001509)
Genome map
AA seq 149 aa AA seqDB search
MKIDGFLKVPDIPGPSIRDGHEEEIEVHGVEFEMQAPFDPNSLSRRGRVSLGMVNFIKNY
DKSSPYLKKALFDNTLLDEVTFSARRTIEGETSDYLVVTLKDASVTSYVMKPSEDEPDLI
EERVGFAYKNINFKYDDKDEVEMDVYVGK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgatggatttctaaaggtccccgacattccggggccaagcatccgcgatggc
cacgaagaagagatcgaagtgcacggagtagagtttgaaatgcaagctcccttcgatccc
aattcattatcgaggaggggccgcgtcagcttgggcatggtcaatttcattaaaaactac
gacaagtcttcgccctacctgaaaaaggctctcttcgacaacacgctcctggacgaagtc
acgttttcggcacgaagaacgatcgaaggcgagacaagcgattatctggtcgtaacctta
aaggatgcatcggtaaccagctacgtaatgaagccaagtgaggacgagccagacctcatc
gaagagcgcgtcggattcgcttacaagaacatcaatttcaagtacgacgataaggacgag
gtcgagatggatgtctatgtcggcaagtga

DBGET integrated database retrieval system