KEGG   Sinorhizobium fredii USDA 257: USDA257_c28630
Entry
USDA257_c28630    CDS       T02188                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfd02044]
    USDA257_c28630
Secretion system [BR:sfd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   USDA257_c28630
SSDB
Motif
Pfam: ImpA_N FliS
Other DBs
NCBI-ProteinID: AFL51434
UniProt: I3X6C8
Position
complement(3003591..3004739)
AA seq 382 aa
MFDSALWLSPLNGNNPSGESLRNDGRFHELERLMQPQIEISRDERNNPVERAEVPVDWTN
VLHKSEELRQHGRDLRLLVIVTRALANEQSFAGLASGLNLIARTFDLHWETMHPELRRDS
PPRDAALRRTNALLQLQNDKDGLLGDLRRMTFFAPHGVGPFTGRDLERGSIDTRTALSEA
APGLSQAEKSSLVSEHDRLLDRMRIGCAAFAEQSSSEAAELVAHARSAATALAELEASLN
RQMGGDVRFTLSDLGRFLQRVISTLERAQPGSRPEIASEEGVVREKVTPQAISGADSSHI
ATAAVFPSRLASREDVTRCIDLVIDFYDRTEPSSPIPHLARRIKRMVPMNFLELMEDLAP
SGLKEFRLLAGMPENKKSRDER
NT seq 1149 nt   +upstreamnt  +downstreamnt
ttgttcgactccgctctctggctaagtccactgaatggcaataacccctctggcgaaagc
ttgcggaatgatgggcgattccacgaactggaacgccttatgcaacctcaaatcgagatc
agccgagacgaacgcaacaatcccgtagaaagggccgaagtacctgtcgactggacaaac
gttcttcataaatctgaggagttgcgtcagcacgggcgggatttgcggctcctggtgatc
gtgactcgagcccttgcaaatgaacagagttttgccggattggcctcgggacttaacctg
atcgctcggactttcgacctgcattgggagacgatgcatccagaacttcggcgggattcc
ccgcctcgggatgcggccctgcgccggaccaacgcacttctccagctgcaaaacgacaag
gatgggttattgggcgaccttcggaggatgaccttttttgcgccccatggtgttggcccc
ttcaccggccgggatttggagcgcggatcgatcgacacccgaaccgctcttagcgaggct
gcacctgggctgagccaggccgagaagtcgtcactcgtaagcgagcatgaccgcttattg
gatcgcatgagaataggctgcgcggcatttgcggaacaatcctcgagcgaagcggccgag
cttgtcgcccatgctcgtagtgcggccactgcactggcggagctcgaagcatcgctcaac
cggcagatgggcggtgatgtgcgcttcacactgtcggatttgggacggttccttcagcgc
gtgatttcgacgctcgagcgagcgcaacccggctcccggccggagatcgcaagcgaggaa
ggcgtcgttcgcgagaaggtaactccacaagcgatctccggcgcggattcgagccacatc
gcaactgcggcagtctttccgtcgcggcttgcctcgcgcgaggatgtcacaaggtgcatc
gacctcgtcattgatttctacgaccgcacggagccgtcaagccccatccctcatctggcg
cgcagaatcaaacgcatggtgccgatgaattttctggaactcatggaggatctggcgccc
tccggtctaaaggagttccggcttttggccggcatgccagaaaacaagaaatctcgggac
gaaaggtga

DBGET integrated database retrieval system