KEGG   Sinorhizobium fredii USDA 257: USDA257_c30940Help
Entry
USDA257_c30940    CDS       T02188                                 

Gene name
cycA
Definition
(GenBank) cytochrome c2
  KO
K08738  cytochrome c
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    USDA257_c30940 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AFL51662
UniProt: I3X706
Position
3247801..3248214
Genome map
AA seq 137 aa AA seqDB search
MTSRLGALVAAVVVFGGIFTGAVEPALALDPAAGDPAAGEKVFRKCQACHAIGPDAKAKT
GPVLTGILGRPAGKAEGFAYSTAMGKVAESGLVWTPDKIGEFLTNPKAFLPGTKMTFAGL
RKDQERADLIAYLAKFP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaagacttggtgccctcgtcgcggctgtagtcgtattcggcggaatattcacg
ggcgcggtcgaaccggcgcttgcgctggatcccgcggcgggtgatccggccgcgggcgag
aaggtctttcgcaagtgtcaggcctgtcacgcgattggtccggatgccaaggcaaagacc
ggccctgtgctgaccggcatactcggccggccagccggcaaagccgaaggctttgcctat
tccactgcgatgggcaaggtggctgagagcggcctggtctggacgccggacaagatcggc
gagtttctgaccaatcccaaagccttcctgcccggcaccaagatgacctttgcgggattg
cgcaaggatcaggagcgcgccgatctgatcgcatatctggcgaagtttccttaa

DBGET integrated database retrieval system