KEGG   Sinorhizobium fredii USDA 257: USDA257_c34740Help
Entry
USDA257_c34740    CDS       T02188                                 

Gene name
tpiA3
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00010  Glycolysis / Gluconeogenesis
sfd00051  Fructose and mannose metabolism
sfd00562  Inositol phosphate metabolism
sfd00710  Carbon fixation in photosynthetic organisms
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01130  Biosynthesis of antibiotics
sfd01200  Carbon metabolism
sfd01230  Biosynthesis of amino acids
Module
sfd_M00002  Glycolysis, core module involving three-carbon compounds
sfd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USDA257_c34740 (tpiA3)
   00051 Fructose and mannose metabolism
    USDA257_c34740 (tpiA3)
   00562 Inositol phosphate metabolism
    USDA257_c34740 (tpiA3)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    USDA257_c34740 (tpiA3)
Enzymes [BR:sfd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     USDA257_c34740 (tpiA3)
Exosome [BR:sfd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   USDA257_c34740 (tpiA3)
  Exosomal proteins of bladder cancer cells
   USDA257_c34740 (tpiA3)
  Exosomal proteins of melanoma cells
   USDA257_c34740 (tpiA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFL52033
UniProt: I3X827
Position
3637078..3637848
Genome map
AA seq 256 aa AA seqDB search
MTPDIRPLVAGNWKMNGTRASLDQIKAMAEGVKGELSAKVETLICPPATLLYVATALCDD
SPLMIGAQNCHQKQSGAHTGEISAEMIADCFGTHVIVGHSERRTDHAETDALVRAKTEAA
YVAELVAIVCIGETEEERKSGKTLDVLRRQLAGSLPDGATAENTVIAYEPVWAIGTGLTP
TVGDVEEAHAFMRSELVSRFGAEGGKMRILYGGSVKPSNAKELMGVANVDGALIGGASLK
AEDFLAIYRAYEELTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatatccgcccgctggttgccggcaactggaagatgaatggtacgcgtgct
tcgctggaccagatcaaggcaatggccgagggcgtcaagggcgaactttccgccaaagtg
gagacgctgatctgcccgccggcgacgctgctttatgttgcaaccgcactttgcgacgac
agtccgctgatgatcggcgctcagaactgccaccagaagcagtcgggcgcccacacgggc
gagatttccgctgagatgatcgccgattgcttcggcacgcatgtcatcgtcggccactcc
gaacgccgcaccgatcatgccgagaccgatgcgctggtacgggcgaagaccgaagccgcc
tacgtggcggaactcgtcgccatcgtctgcatcggcgagaccgaagaagaacgcaagagc
ggcaagacgctcgacgtcctgaggcgccagctcgccggaagcttgccggatggcgcgaca
gccgagaataccgtgatcgcctatgagccggtctgggcgatcggcacgggcctgacgccg
acggtgggagatgtggaagaggcgcatgccttcatgcgcagtgaacttgtctcgcgcttc
ggcgccgagggcggcaagatgcgcatcctctacggcggctctgtcaagccatcaaatgcc
aaggaactgatgggcgtcgccaatgtagacggtgcgctgatcggaggcgccagcttgaaa
gcggaagacttcctcgccatctaccgggcctatgaagaattgactgcgtga

DBGET integrated database retrieval system