KEGG   Sinorhizobium fredii USDA 257: USDA257_c35520Help
Entry
USDA257_c35520    CDS       T02188                                 

Gene name
pcm3
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
Enzymes [BR:sfd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     USDA257_c35520 (pcm3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_11 GidB TehB Methyltransf_23 Methyltransf_32 MTS Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: AFL52111
UniProt: I3X8A5
Position
3714338..3714997
Genome map
AA seq 219 aa AA seqDB search
MNFEAARIKMVDNQIRTTDVTSHSVLTAFLSVPREEFVPAKMKELAYIDTDIELTGGTAP
RYLMEPSPLAKLLQLAEISKPDKVLEIGSGTGYASAVLSLIAGSVVALESDESLAGSATE
TLARLDYGNVTVATGDLTKGHAAEAPYDVIFINGAVEVIPASLFEQLRDGGRLVAVEGFG
NASRAKLYVRESGRTSERSDFNTSVKPLPGFHRARSFIF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgaagcagcgcgcattaagatggtggacaatcagatccgaacgacggatgtg
acatcccattcggttctgactgccttcctctcggtgccacgcgaggaattcgtgccagcg
aagatgaaggaactggcctatatcgataccgatatcgagctcactggcggcaccgccccg
cgctacctcatggagccttctccgctggccaaattgctgcagctcgccgagatcagcaaa
ccggacaaggtgctcgagatcggttcggggaccggttacgcttccgcggtgctatcgctc
atcgccggctccgtcgtggcgctggagagtgatgagtcgttggccgggtcagcgaccgag
acgctggcgcgtctcgactatggcaatgttacggtcgcgactggcgatctcaccaaggga
cacgctgccgaagcgccctatgacgtgatcttcatcaacggcgcggttgaagtgattccc
gcttcccttttcgagcagcttcgagacggcggccgcctggtcgccgttgaagggtttggt
aacgcatcgcgtgcgaaactctatgtacgcgaatcgggcaggacgtccgagcgatccgat
ttcaacacgtcggtgaagccgctgcctggcttccatcgcgcgcggtcgttcattttctga

DBGET integrated database retrieval system