KEGG   Sinorhizobium fredii USDA 257: USDA257_c57130Help
Entry
USDA257_c57130    CDS       T02188                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase PhbA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00071  Fatty acid degradation
sfd00072  Synthesis and degradation of ketone bodies
sfd00280  Valine, leucine and isoleucine degradation
sfd00310  Lysine degradation
sfd00362  Benzoate degradation
sfd00380  Tryptophan metabolism
sfd00620  Pyruvate metabolism
sfd00630  Glyoxylate and dicarboxylate metabolism
sfd00640  Propanoate metabolism
sfd00650  Butanoate metabolism
sfd00900  Terpenoid backbone biosynthesis
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01130  Biosynthesis of antibiotics
sfd01200  Carbon metabolism
sfd01212  Fatty acid metabolism
sfd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    USDA257_c57130 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    USDA257_c57130 (phbA)
   00640 Propanoate metabolism
    USDA257_c57130 (phbA)
   00650 Butanoate metabolism
    USDA257_c57130 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    USDA257_c57130 (phbA)
   00072 Synthesis and degradation of ketone bodies
    USDA257_c57130 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    USDA257_c57130 (phbA)
   00310 Lysine degradation
    USDA257_c57130 (phbA)
   00380 Tryptophan metabolism
    USDA257_c57130 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    USDA257_c57130 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    USDA257_c57130 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    USDA257_c57130 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfd04147]
    USDA257_c57130 (phbA)
Enzymes [BR:sfd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     USDA257_c57130 (phbA)
Exosome [BR:sfd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   USDA257_c57130 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFL54224
UniProt: I3XEB8
Position
5934930..5936111
Genome map
AA seq 393 aa AA seqDB search
MSNPSIVIASAARTAVGSFNGAFGNTPAHELGATVIKAVLERAGVEAAEVHEVILGQVLQ
AGEGQNPARQAAIKAGLPPEKTAWGMNQLCGSGLRAVALGMQQIAIGDANIIVAGGMESM
SMAPHCAHLRGGVKMGDYKMIDTMIKDGLTDAFYGYHMGITAENVARKWQLTREEQDEFA
LRSQNKAEAAQKAGRFADEIVPFIVKTRKGDVSVDQDEYIRHGATLDSIAKLRPAFDKEG
TVTAANASGLNDGAAATLLMTEVEAARRGIQPLARIVSWATAGVDPQIMGTGPIPASRKA
LEKAGWSVGDVELVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARVLN
TLLFEMKRRGVSKGLATLCIGGGMGVAMCVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatccctccatcgtgatcgccagcgccgctcgcaccgcagtcgggtccttcaac
ggcgccttcggcaacacacccgctcatgaactgggtgcaacggtcatcaaggcggtcctc
gaacgggccggcgtcgaggcggcagaggtccacgaggtgattctcggccaggtgcttcag
gccggcgaagggcagaacccggcccgccaggcggcgatcaaggccggcctcccgccggaa
aagaccgcctggggcatgaaccagctttgcggctcgggcctgcgcgcggtcgccctcggc
atgcagcagatcgccatcggcgacgcgaacatcatcgtcgccggcggcatggaatcgatg
tcgatggcaccgcattgcgcgcatctgcgcggcggcgtcaagatgggcgactacaagatg
atcgacacgatgatcaaggacggcctgacggacgccttttacggctaccacatgggcatc
accgccgaaaacgtcgcgcgtaagtggcagctgacccgtgaggagcaggacgaattcgcg
ctccgctcgcagaacaaggcggaagcggcgcagaaggccggccggttcgccgacgaaatc
gtcccgttcatcgtcaagacccgcaagggcgacgtcagcgtcgaccaggacgaatatatc
cgccacggcgccacgctcgattcgatcgccaagctgcgtccggccttcgacaaggagggt
acggtcaccgcggccaacgcctcggggctcaatgacggcgctgccgcaacgctgctgatg
accgaggtcgaggccgccaggcgcggcattcagccgctcgcccgcatcgtctcctgggcg
acggccggcgtcgacccgcagatcatgggcaccggcccgatccccgcctcgcgcaaggcg
ctcgaaaaggccggctggtcggtcggcgacgtcgaactcgtcgaggccaacgaagccttc
gcggcgcaggcctgcgcggtcaacaaggatctcggctgggatccgtcgatcgtcaacgtc
aacggcggcgcgatcgccatcggccacccgatcggcgcttccggtgcccgcgtcctcaac
acgctgctcttcgaaatgaagcgccgtggtgtttccaagggcctcgcaacgctgtgcatc
ggcggcggcatgggcgtcgccatgtgcgtcgagcgcctgtaa

DBGET integrated database retrieval system