KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_0634Help
Entry
SFxv_0634         CDS       T01883                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00020  Citrate cycle (TCA cycle)
sfe00190  Oxidative phosphorylation
sfe00650  Butanoate metabolism
sfe01100  Metabolic pathways
sfe01110  Biosynthesis of secondary metabolites
sfe01120  Microbial metabolism in diverse environments
sfe01130  Biosynthesis of antibiotics
sfe01200  Carbon metabolism
Module
sfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sfe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SFxv_0634 (sdhD)
   00650 Butanoate metabolism
    SFxv_0634 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SFxv_0634 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADA72947
UniProt: D2A9F8
Position
complement(615296..615643)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgaactgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system