KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_0681Help
Entry
SFxv_0681         CDS       T01883                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00520  Amino sugar and nucleotide sugar metabolism
sfe01100  Metabolic pathways
sfe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SFxv_0681 (nagA)
Enzymes [BR:sfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SFxv_0681 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ADA72985
UniProt: D2A9Y0
Position
663252..664400
Genome map
AA seq 382 aa AA seqDB search
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL
NGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAK
HPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEV
ISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEAD
IYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIDVEKRLGTLAAGKVANL
TAFTPDFKITKTIVNGNEVVTQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcattaacccagggccggatctttaccggccacgaatttcttgatgaccacgcg
gttgttatcgctgatggcctgattaaaagcgtctgtccggtagcggaactgccgccagag
atcgaacaacgttcactgaacggggccattctctcccccggttttatcgatgtgcagtta
aacggctgcggcggcgtacagtttaacgacaccgctgaagcggtcagcgtggaaacgctg
gaaatcatgcagaaagccaatgagaaatcaggctgtactaactatctgccgacgcttatc
accaccagcgatgagctgatgaaacagggcgtgcgcgttatgcgtgagtacctggcaaaa
catccgaatcaggcgttaggtctgcatctggaaggtccgtggctgaatctggtaaaaaaa
ggcacccataatccgaattttgtgcgtaagcctgatgccgcgctggtcgatttcctgtgt
gaaaacgccgacgtcattaccaaagtgaccctggcaccggaaatggttcctgcggaagtc
atcagcaaactggcaaatgccgggattgtggtttctgccggtcactccaacgcgacgttg
aaagaagcaaaagccggtttccgcgcggggattacctttgccacccatctgtacaacgcg
atgccgtatattaccggtcgtgaaccgggcctggcgggcgcgatcctcgacgaagctgac
atttattgcggtattatcgctgatggcctgcatgttgattacgccaacattcgtaacgct
aaacgccttaaaggcgacaaactgtgtctggttaccgacgccaccgcgccagcaggtgcc
aacattgaacagttcatttttgcgggtaaaacaatatactaccgtaacggactttgtgtg
gatgagaacggtacgttaagcggttcatccttaaccatgattgaaggcgtgcgtaatctg
gtcgaacattgcggtatcgcactggatgaagtgctgcgtatggcgacgctctatccggcg
cgtgcgattgacgttgaaaaacgtctcggcacgctcgccgcaggtaaagtagccaacctg
accgcattcacacctgattttaaaatcaccaagaccatcgttaacggtaacgaggtcgta
actcaataa

DBGET integrated database retrieval system