KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_2349Help
Entry
SFxv_2349         CDS       T01883                                 

Gene name
cpsB
Definition
(GenBank) Mannose-1-phosphate guanyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00051  Fructose and mannose metabolism
sfe00520  Amino sugar and nucleotide sugar metabolism
sfe01100  Metabolic pathways
sfe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SFxv_2349 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    SFxv_2349 (cpsB)
Enzymes [BR:sfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     SFxv_2349 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADA74487
UniProt: D2A6X9
Position
complement(2183005..2184441)
Genome map
AA seq 478 aa AA seqDB search
MAQSKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVIC
NEQHRFIVAEQLRQLNKLTENIILEPAGRNTAPAIALAALAAKRHSPESDPLMLVLAADH
VIADEDAFRAAVRNAMPYAEAGKLVTFGIVPDLPETGYGYIRRGEVSVGEQDTVAFEVAQ
FVEKPNLETAQAYVASGEYYWNSGMFLFRAGRYLEELKKYRPDILDACEKAMSAVDPDLD
FIRVDEEAFLACPEESVDYAVMEPTADAVVVPMDAGWSDVGSWSSLWEISAHTAEGNVCH
GDVINHKTENSYVYAESGLVTTVGVKDLVVVQTKDAVLIADRNAVQDVKKVVEQIKADGR
HEHRVHREVYRPWGKYDSIDAGDRYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTAKVT
IDGDIKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFADRYGRV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtcgaaactctatccagttgtgatggcaggtggctccggtagccgtttatgg
ccgctttcccgcgtactttaccccaagcagtttttatgcctgaaaggcgatctcaccatg
ctgcaaaccaccatctgccgcctgaacggcgtggagtgcgaaagcccggtggtgatttgc
aatgagcagcaccgctttattgtcgcggaacagctgcgtcaactgaacaaactcaccgag
aacattattctcgaaccggcagggcgtaacactgcacctgccattgcactggcggcgctg
gcggcaaaacgtcatagcccggagagcgacccgttaatgctggtattggcggcggatcat
gtgattgccgatgaagacgcgttccgtgccgccgtgcgtaatgccatgccttatgccgaa
gcgggcaagctggtgacctttggcattgtgccggatctaccagaaaccggttatggctat
attcgtcgcggtgaagtgtctgtgggtgagcaggatacggtggcctttgaagtggcgcag
tttgtcgaaaaaccgaatctggaaaccgcccaggcctatgtagcaagcggcgaatattac
tggaacagcggcatgttcctgttccgcgccggacgctatctcgaagaactgaaaaaatat
cgcccggatatcctcgatgcctgcgaaaaagcgatgagcgccgtcgatccggatctcgat
tttattcgtgtggatgaagaagcgtttctcgcctgcccggaagagtcggtggattacgcg
gtcatggaacctacggcagatgctgttgtggtgccgatggatgcgggctggagcgatgtt
ggttcctggtcttcattatgggagatcagcgcccacaccgccgagggcaacgtttgccac
ggcgatgtgattaatcacaaaactgaaaacagctatgtgtatgccgaatcaggcctggtc
accaccgtcggggtgaaagatctggtagtggtgcagaccaaagatgcggtgctgattgcc
gaccgtaacgcggtacaggatgtgaaaaaagtggtcgagcagatcaaagccgatggtcgc
catgagcatcgggtgcatcgcgaagtgtatcgtccgtggggcaaatatgactctatcgac
gcgggcgaccgctaccaggtgaaacgcatcaccgtgaaaccgggcgagggtttgtcggta
cagatgcaccatcaccgcgcggaacactgggtagtggtcgcgggaacggcaaaagtcacc
attgatggtgatatcaaactgcttggtgaaaacgagtccatttatattccgctgggggcg
acgcactgcctggaaaacccggggaaaattccgctcgatttaattgaagtgcgctccggc
tcttatctcgaagaggatgatgtggtgcgcttcgcggatcgctacggacgggtgtaa

DBGET integrated database retrieval system