KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_2577Help
Entry
SFxv_2577         CDS       T01883                                 

Gene name
arnA
Definition
(GenBank) Bifunctional polymyxin resistance protein arnA
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00520  Amino sugar and nucleotide sugar metabolism
sfe01100  Metabolic pathways
sfe01503  Cationic antimicrobial peptide (CAMP) resistance
Module
sfe_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SFxv_2577 (arnA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SFxv_2577 (arnA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sfe01005]
    SFxv_2577 (arnA)
Enzymes [BR:sfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     SFxv_2577 (arnA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     SFxv_2577 (arnA)
Lipopolysaccharide biosynthesis proteins [BR:sfe01005]
 Unusual sugar
  SFxv_2577 (arnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 Sacchrp_dh_NADP NAD_binding_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ADA74682
UniProt: D2AFW0
Position
2420157..2421707
Genome map
AA seq 516 aa AA seqDB search
MAQLRVAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNILEIAQRENEATCFGRRTPD
DSFLEWHKPASVLHNMVRAVADPWPGAFSYVGNQKFTVWSSRVHPHASKAQPGSVISVAP
LLIACGDGALEIVTGQAGDGITMQGSQLAQMLGLVQGSRLNSQPACTARRRTRVLILGVN
GFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCD
VVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYF
DEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFLPFNWMGPRLDNLNAA
RIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDIRDGIEALYHIIENAGNRCDGEIIN
IGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVVESSCYYGKGYQDVEHRKPSIR
NAHRCLDWEPKIDMQETIDETLDFFLRTVDLTDKPS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaactgcgcgttgccattgcgccagacgatatcgctattacgctgcatcataaa
ttgtgccatgccgcgcgccagctactggaacagacattacccgccattaaacacggtaat
attctggaaatcgcccagcgcgaaaacgaagccacctgttttggtcgcagaacgccggat
gacagtttccttgaatggcataaaccggcatccgtactgcacaacatggtacgtgccgtt
gccgatccgtggccgggtgccttcagctatgttggcaatcagaaattcaccgtctggtcg
tcgcgtgttcatcctcatgccagcaaagcacagccggggagcgtgatttctgttgcgcca
ctgctgattgcctgtggcgatggcgcgctggaaatcgtcaccggacaggcgggcgacggc
attactatgcagggctcgcaattagcgcagatgctgggcctggtgcaaggttcacgcttg
aatagccagcctgcctgcaccgcccgacgccgtacccgggtactcatcctcggggtgaat
ggctttattggcaaccatctgacagaacgcctgctgcgcgaagatcattatgaagtttac
ggtctggatattggcagcgatgcgataagccgttttctgaatcatccacattttcacttt
gtcgaaggcgatatcagtattcattccgaatggattgagtatcacgtcaaaaaatgtgat
gtcgtcttgccgctggtggcgatagccacgccgattgaatatacccgcaacccgctgcgc
gtatttgaactcgattttgaagagaatctgcgcattatccgctactgcgttaagtaccgt
aagcgaatcatcttcccgtcaacttcagaagtttatgggatgtgtagcgataaatacttc
gatgaggaccattctaatttaatcgtcggcccggtgaataaaccacgctggatttattcg
gtgtcaaaacaattacttgatcgggtgatctgggcctatggcgaaaaagagggtttacag
ttcaccctcttcctcccgtttaactggatgggaccacgactggataaccttaatgcagcg
cgaattggcagctcccgcgctattacgcaactcattctcaatctggtagaaggttcacca
attaagctaattgatggcggaaaacaaaaacgctgctttactgatatccgggacggtatc
gaggcgttgtaccacattatcgaaaatgcgggaaatcgctgcgacggcgaaattatcaac
attggcaatcctgagaacgaagcgagcattgaggaactgggcgagatgctgctggcgagc
ttcgaaaaacatccgctgcgccatcatttcccaccgtttgcgggctttcgcgttgtcgaa
agtagctgctactacggcaaaggatatcaggacgtagagcatcgtaaaccgagcatccgc
aatgcccaccgctgcctggactgggagccgaaaattgatatgcaggaaaccatcgacgaa
acgctggatttcttcctgcgcaccgttgatcttacggataaaccatcatga

DBGET integrated database retrieval system