KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_3128Help
Entry
SFxv_3128         CDS       T01883                                 

Gene name
yqeF
Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00071  Fatty acid degradation
sfe00280  Valine, leucine and isoleucine degradation
sfe00310  Lysine degradation
sfe00362  Benzoate degradation
sfe00380  Tryptophan metabolism
sfe00620  Pyruvate metabolism
sfe00630  Glyoxylate and dicarboxylate metabolism
sfe00640  Propanoate metabolism
sfe00650  Butanoate metabolism
sfe00900  Terpenoid backbone biosynthesis
sfe01100  Metabolic pathways
sfe01110  Biosynthesis of secondary metabolites
sfe01120  Microbial metabolism in diverse environments
sfe01130  Biosynthesis of antibiotics
sfe01200  Carbon metabolism
sfe01212  Fatty acid metabolism
sfe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SFxv_3128 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SFxv_3128 (yqeF)
   00640 Propanoate metabolism
    SFxv_3128 (yqeF)
   00650 Butanoate metabolism
    SFxv_3128 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SFxv_3128 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SFxv_3128 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFxv_3128 (yqeF)
   00310 Lysine degradation
    SFxv_3128 (yqeF)
   00380 Tryptophan metabolism
    SFxv_3128 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SFxv_3128 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SFxv_3128 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SFxv_3128 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfe04147]
    SFxv_3128 (yqeF)
Enzymes [BR:sfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SFxv_3128 (yqeF)
Exosome [BR:sfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFxv_3128 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: ADA75183
UniProt: D2A6Z9
Position
complement(2984533..2985714)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGEQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMIQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggtgcg
ttagcgggtcattccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtcttcctaacagcgtttct
gcaatcacgattaatgacgtttgcggttccggtcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgcaggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgaacagcttggcaatagccagttggtt
gacagtctggtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgatccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgaccgcggggaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaagggctggcaacgctttgtatcggc
gggggccagggcgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system