KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_3143
Entry
SFxv_3143         CDS       T01883                                 

Gene name
xdhC
Definition
(GenBank) Xanthine dehydrogenase iron-sulfur-binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00230  Purine metabolism
sfe01100  Metabolic pathways
sfe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SFxv_3143 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ADA75197
UniProt: D2A713
Position
3001858..3002337
AA seq 159 aa
MNHSETITTECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGTVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccaccgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcaca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system