KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_3659Help
Entry
SFxv_3659         CDS       T01883                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SFxv_3659 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sfe03011]
    SFxv_3659 (rplV)
Ribosome [BR:sfe03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SFxv_3659 (rplV)
  Bacteria
    SFxv_3659 (rplV)
  Archaea
    SFxv_3659 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Mic1 Peptidase_U40
Motif
Other DBs
NCBI-ProteinID: ADA75664
UniProt: D2A905
Position
complement(3470300..3470632)
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVQVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctaaacatcgccatgctcgttcttctgctcagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggctctggatattttgacctacaccaac
aagaaagcggctgtacaggtcaagaaagttctggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgacgatctgaaagttacgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacatcactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system