KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_3735Help
Entry
SFxv_3735         CDS       T01883                                 

Gene name
pck
Definition
(GenBank) Phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00010  Glycolysis / Gluconeogenesis
sfe00020  Citrate cycle (TCA cycle)
sfe00620  Pyruvate metabolism
sfe01100  Metabolic pathways
sfe01110  Biosynthesis of secondary metabolites
sfe01120  Microbial metabolism in diverse environments
sfe01130  Biosynthesis of antibiotics
sfe01200  Carbon metabolism
Module
sfe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFxv_3735 (pck)
   00020 Citrate cycle (TCA cycle)
    SFxv_3735 (pck)
   00620 Pyruvate metabolism
    SFxv_3735 (pck)
Enzymes [BR:sfe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     SFxv_3735 (pck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ADA75737
UniProt: D2A9K2
Position
3538148..3539770
Genome map
AA seq 540 aa AA seqDB search
MRVNNGLPPQELEAYGISDVHDIVYNPSYDLLYQEELDPSLTGYERGVLTNLGAVAVDTG
IFTGRSPKDKYIVRDDTTRDTFWWADKGKGKNDNKPLSPETWQHLKGLVTRQLSGKRLFV
VDAFCGANPDTRLSVRFITEVAWQAHFVKNMFIRPSDEELAGFKPDFIVMNGAKCTNPQW
KEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVGEK
GDVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPEI
YNAIRRDALLENVTVREDGTIDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFL
TADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTQ
YAEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDNAETFTLPMFNL
AIPTELPGVDTKILDPRNTYASPEQWQEKAETLAKLFIDNFDKYTDTPAGAALVAAGPKL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaacaatggtttgcccccgcaagaactcgaggcttatggtatcagtgacgta
catgatatcgtttacaacccaagctacgacctgctgtatcaggaagagctcgatccgagc
ctgacaggttatgagcgcggggtgttaactaatctgggtgccgttgccgtcgataccggg
atcttcaccggtcgttcaccaaaagataagtatatcgtccgtgacgataccactcgcgat
actttctggtgggcagacaaaggcaaaggtaagaacgacaacaaacctctctctccggaa
acctggcagcatctgaaaggcctggtgaccaggcagctttccggcaaacgtctgttcgtt
gtcgacgctttctgtggtgcgaacccggatactcgtctttccgtccgtttcatcaccgaa
gtggcctggcaggcgcattttgtcaaaaacatgtttattcgcccgagcgatgaagagctg
gcaggtttcaaaccagactttatcgttatgaacggcgcgaagtgcactaacccgcagtgg
aaagaacagggtctgaactccgaaaacttcgtggcgtttaacctgaccgagcgcatgcag
ctgattggcggcacctggtacggcggcgaaatgaagaaagggatgttctcgatgatgaac
tacctgctgccgctgaaaggtatcgcttctatgcactgctccgccaacgttggcgagaaa
ggcgatgttgcggtgttcttcggcctttccggcaccggtaaaaccaccctttccaccgac
ccgaaacgccgcctgattggcgatgacgaacacggctgggacgatgacggcgtgtttaat
ttcgaaggcggctgctacgcaaaaactatcaagctgtcgaaagaagcggaacctgaaatc
tacaacgctatccgtcgtgatgcgctgctggaaaacgtcaccgtgcgtgaagatggcact
atcgactttgatgatggttcaaaaaccgagaacacccgcgtttcttatccaatctatcac
atcgataacatcgttaagccggtttccaaagcgggccacgcgactaaggttatcttcctg
actgctgatgctttcggcgtgttgccgccggtttctcgcctgactgccgatcaaacccag
tatcacttcctctctggcttcaccgccaaactggccggtactgagcgtggcatcaccgaa
ccgacgccaaccttctccgcttgcttcggcgcggcgttcctgtcgctgcacccgactcag
tacgcagaagtgctggtgaaacgtatgcaggcggcgggcgcgcaggcttatctggttaac
actggctggaacggcactggcaaacgtatctcgattaaagatacccgcgccattatcgac
gccatcctcaacggttcgctggataatgcagaaaccttcactctgccgatgtttaacctg
gcgatcccaaccgaactgccgggcgtagacacgaagattctcgatccgcgtaacacctac
gcttctccggaacagtggcaggaaaaagccgaaaccctggcgaaactgtttatcgacaac
ttcgataaatacaccgacacccctgcgggtgccgcgctggtagcggctggtccgaaactg
taa

DBGET integrated database retrieval system