KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_3841Help
Entry
SFxv_3841         CDS       T01883                                 

Gene name
uspB
Definition
(GenBank) Universal stress protein B
  KO
K06144  universal stress protein B
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfe02000]
    SFxv_3841 (uspB)
Transporters [BR:sfe02000]
 Other transporters
  Others
   SFxv_3841 (uspB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UspB
Motif
Other DBs
NCBI-ProteinID: ADA75834
UniProt: D2AA67
Position
complement(3649923..3650258)
Genome map
AA seq 111 aa AA seqDB search
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV
RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgataagcaccgtcgcattattttgggctttatgtgtcgtttgcattgttaacatggcg
cgctatttctcatcactacgcgcgttgttagtggtactgcgtaactgcgatccattgctc
tatcaatatgttgatggagggggcttttttacctcacatggccaacccaacaaacaggtg
cgtctcgtttggtatatctatgcccaacgttatcgcgatcatcacgatgatgagtttatt
cgccgctgtgagcgggtgcgtcggcagtttattctgactagcgcattgtgtggtctggtg
gtggtcagcctgattgcattgatgatttggcattaa

DBGET integrated database retrieval system