KEGG   Serratia fonticola GS2: AV650_13990
Entry
AV650_13990       CDS       T04716                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00230  Purine metabolism
sfg01100  Metabolic pathways
sfg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AV650_13990
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ALX94599
UniProt: A0A0U4IVK4
Position
complement(3089471..3089947)
AA seq 158 aa
MLINCTINGRPYQFEVDPRLSLMELLRQQGLNSVKQGCSVGECGACTVLIDDVATDTCIY
LALWADGKTIRTTEGEVKQGKLSAVQQAYVNVGAVQCGFCTPGLVMTSTSMVERFRGHRL
TEQEIRRGLAGNLCRCTGYTSIVKAVEQAQQLDEEMPR
NT seq 477 nt   +upstreamnt  +downstreamnt
atgttgatcaattgcaccatcaatggccgcccctatcagttcgaggtcgatccccgcctg
tcgctgatggagttactgcgccagcaagggcttaacagcgtcaaacaagggtgcagcgtg
ggcgagtgtggtgcctgtaccgtactgatcgacgatgtcgctacggacacctgtatttat
ctggcgctctgggccgatggcaaaaccatccgcactaccgagggcgaggtgaaacagggc
aaactctctgccgtacagcaggcttatgtgaatgtgggggcggtgcaatgtggtttttgt
acgccggggttggtgatgaccagtacctcaatggtggaacgctttcgcggccaccgcctc
accgagcaggagatccgccgcggcctggccgggaatttatgccgctgcaccggctatacc
tcgatcgtcaaggcagtggagcaggcgcagcagttggatgaggaaatgccgcgttga

DBGET integrated database retrieval system