KEGG   Serratia fonticola GS2: AV650_14000
Entry
AV650_14000       CDS       T04716                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00230  Purine metabolism
sfg01100  Metabolic pathways
sfg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AV650_14000
Enzymes [BR:sfg01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     AV650_14000
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ALX94601
UniProt: A0A0U3ZYB2
Position
complement(3090835..3093120)
AA seq 761 aa
MPVGTSPERVDAQAKVTGRARYTDDMTMPGMRHAKYVRSPIAHGLVTRIDTSKALQLPGV
EAIFTYQDVPQHGFPTAGHAWSLDANKRDVADKQLLTQHVRHHGDGVAIVVACNALTAEK
AAMLVEVEYQELPAMTTAKTALAADAPLLHGGKSNLLKQHQLSGGDPVAALAASEIVIEG
NYSTQVVQHCHLEGVISYAYMDEMDRIVIVSSTQIPHLVRRVVGQALDRPWSSIRVIKPY
IGGGFGNKQDVLEEPMAAFLTWKLGGVPVKVELSREECFLASRTRHSFAISGKMGINRDG
ILQTYSLDVLSNTGGYASHGHSIASAGANKIAYLYPRIAFGYQATTFYSNLPNAGAMRGY
GAPQVTFALECMIDEAAAQLGMDPLELRLKNVARQGDLNPLNHKEIKSAGIIECLQKGRE
LFEWDARRAACLNQSGPIRRGVGVACLSYASNTYPVGVEIASARLLLNQDGTVHLQVGAT
EIGQGSDTVFAQMAAQTIGVPFSSLYVISTQDTDITAYDPGAFASRQSYVAAPAIRQAAT
ELRAKILTHAAYMCSQPEWALDVINGEVVLKEMPEKVLCSVQEVSMSAHYDQEVGGQIMA
EVSCKTRSNPPAFGCTFVDLTVDIELCKVTINKIMNLHDSGQILNPLLAEGQVHGGMGMG
IGWTLFEEMIIDEQSGIVRNNNLLDYKFPTILDLPELDCAFVETYEPQSAYGHKALGEPP
LISPAPAIRNAIWMATGVKIDELPLTPKTLYRYFSQAGLIE
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgcctgtaggaacctcgcccgaacgcgtcgatgcgcaagccaaagtcaccggccgggca
cgttataccgacgatatgaccatgccgggtatgcgtcatgccaaatatgttcgtagcccg
attgcccatggtctggttacgcgtatcgacaccagcaaagccctgcaactgccaggggtg
gaagccatattcacttatcaggatgtgccgcagcatggttttccgactgccggccacgcc
tggtcgctggatgccaataagcgtgacgtagcggataaacagttgctgacccagcatgta
cgccatcacggcgatggcgtggcgatcgtggtcgcctgcaacgcgttaacggcagagaaa
gccgccatgctggttgaagtggaatatcaggaactgccagcgatgaccacagcaaaaacc
gcgctggcagccgatgcgccgctgttacacggtggcaaaagcaatctgctgaaacagcac
cagctcagcggcggcgatcccgtggcagcattggctgcatcagagatcgtgatcgaaggc
aactacagcacgcaggtagtgcaacattgtcatctggaaggggtgatttcctacgcttac
atggacgagatggatcgcatcgtgatcgtctccagcacccaaattccccatctggtacgc
cgtgtggtaggccaggcgctagatcggccatggtcgtccatccgggtgatcaagccctat
atcggcggtgggttcggcaataagcaggacgtcttggaagagccgatggccgcattcctg
acctggaaactcggcggcgtgccggtcaaggttgaactgagccgcgaagagtgttttttg
gcatctcgtacccgtcactcgttcgccatcagcggtaagatgggcattaaccgcgacggc
atcctgcaaacctatagcctggatgtgctctccaataccggagggtatgcatctcacggc
cactccattgcctccgccggggccaataaaatcgcctatttgtatccgcgtatcgccttc
ggctaccaagccaccaccttttattccaacctgccgaacgccggtgccatgcgcggctac
ggtgcacctcaggtgacctttgccctggaatgcatgattgacgaagccgccgcccaactg
gggatggatccgctggaactgcggctcaaaaacgtcgcccgccaaggagatctcaatccg
ctcaatcacaaggagatcaagagcgccgggattatcgagtgcctgcaaaaaggccgggaa
ctgtttgagtgggatgcccgtcgtgccgcctgcctgaaccaaagtggccccatccgccgc
ggcgttggcgtggcttgcctgagctatgcgtccaatacctatccagttggcgtcgagatt
gctagcgctcggctgttactgaaccaggatggcaccgtccatctgcaagtcggcgcgacg
gaaattggccagggatcggataccgtgtttgcacaaatggcggcgcaaaccatcggcgtg
cccttctcttccctctacgttatctccacccaagacaccgatattaccgcctacgatccc
ggtgccttcgcctcacggcaaagctatgttgcagcccctgccattcgccaggccgctaca
gagttgcgcgccaagatcctgacccatgcagcctatatgtgcagccagcccgaatgggcg
ctggatgtgatcaacggcgaggtggtgctgaaggagatgccagaaaaagtgttgtgctcg
gtgcaagaggtctccatgagcgcccattacgatcaggaggtcggcgggcagattatggcc
gaggtgtcctgcaaaacccgcagcaatccacccgcctttggctgcacctttgttgacctc
accgtcgatattgagctgtgtaaggtcaccatcaacaagatcatgaatctgcacgactcc
ggccagatccttaacccgctgttggccgagggccaggtgcatggcggcatggggatgggc
atcggctggacgctattcgaagagatgatcatcgacgagcaaagcggcatcgtgcgcaat
aacaatctgctggattacaagttccctaccattctcgatctgccagagttggactgtgcg
tttgtcgaaacctatgagccacaatccgcctatgggcacaaggcgctgggtgaaccgccg
ctgatctctcccgccccggcgatccgcaacgccatctggatggcaaccggcgtgaagata
gatgagttaccactaacgcccaaaacgctctatcgctatttttcgcaagcgggcctgatc
gagtaa

DBGET integrated database retrieval system