KEGG   Serratia fonticola GS2: AV650_25615Help
Entry
AV650_25615       CDS       T04716                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00010  Glycolysis / Gluconeogenesis
sfg00020  Citrate cycle (TCA cycle)
sfg00620  Pyruvate metabolism
sfg01100  Metabolic pathways
sfg01110  Biosynthesis of secondary metabolites
sfg01120  Microbial metabolism in diverse environments
sfg01130  Biosynthesis of antibiotics
sfg01200  Carbon metabolism
Module
sfg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AV650_25615 (aceF)
   00020 Citrate cycle (TCA cycle)
    AV650_25615 (aceF)
   00620 Pyruvate metabolism
    AV650_25615 (aceF)
Enzymes [BR:sfg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AV650_25615 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA DUF1223
Motif
Other DBs
NCBI-ProteinID: ALX96707
UniProt: A0A0U4JQT6
Position
complement(5586138..5588015)
Genome map
AA seq 625 aa AA seqDB search
MSIEIKVPDIGADEVEITEILVKVGDKVEVEQSLITVEGDKASMEVPSPQAGVVKEIKVA
VGDKTETGKLLMIFEAEGAAAAAPAAKAEEKPAAAPAAAAAKDVEVPDIGADEVEVTEIL
VKVGDTVTAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVKTGSLIMVFEVAGAAS
AAPAAAATQAAPAAAPAASAAKNVEVPDIGGDEVEVTEVMVKVGDKVAAEQSLITVEGDK
ASMEVPAPFAGTVKEIKIATGDKVKTGSLIMVFEVEGAAPAPAAAPAQKAEAAPAPAKQE
AKAAAPAAAAGKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQAYV
KDAVKRAEAAPAATGGGLPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPH
VTHFDKTDITDLEAFRKQQNDEAAKRKLDVKFTPVVFIMKAVAAALEQMPRFNSSLSEDG
QKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELMAISKKARDGKLTAGEMQG
GCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFTPRLMMPMSLSFDHRV
IDGADGARFITIINNMLADIRRLVM
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgaaatcaaagtgccggacatcggtgcagatgaagttgaaatcaccgagatc
ctggtgaaggttggcgataaggttgaagttgaacaatcgctgatcaccgtggaaggcgac
aaagcctccatggaagtgccttcgccgcaggctggcgtggtcaaagagatcaaagtggcc
gtcggtgataaaaccgagactggcaaactgctgatgatctttgaagcagaaggtgcggcc
gctgccgcaccagccgccaaggcagaagaaaaaccggccgcggctcctgctgctgccgca
gccaaagacgttgaagtaccggacatcggggctgatgaagttgaagtcaccgagatcctg
gtgaaggttggcgataccgtgactgccgagcagtctctgatcaccgtagaaggcgacaag
gcctctatggaagtgcctgcaccgttcgctggtaccgtgaaagagatcaaaatcaacacc
ggtgacaaagtgaaaaccggttccctgattatggtcttcgaagtggctggcgcggcttct
gctgcccctgctgctgcggctacccaggcggctccggctgctgcccctgcggcaagcgcg
gcgaaaaacgtcgaagtgccagacattggcggcgacgaagtagaagtgaccgaagtgatg
gtgaaagtgggcgataaagttgccgctgagcagtcactgatcaccgttgaaggtgacaag
gcttctatggaagttccggctccgttcgcgggcaccgtgaaagaaatcaaaatcgctacc
ggcgacaaagtgaaaaccggttctctgatcatggtgttcgaagtggaaggcgctgcacca
gcacctgccgctgctccggcccagaaagcagaagctgctccggctccggccaagcaggaa
gccaaagcggctgcacctgccgccgccgccggtaaaggcgagttcgctgaaaacgacgcc
tacgttcacgcgaccccagtcatccgccgcttggcgcgtgagttcggtgttaacctggca
aaagtgaagggcacaggtcgtaaaggccgtatcctgcgcgaagacgttcaggcttacgtg
aaagacgcggtcaaacgcgccgaagccgctcctgccgctaccggtggtggcctgccaggc
atgttgccttggccgaaagtggacttcagcaagtttggtgagatcgaagaagttgaactg
ggccgcatccagaaaatctctggtgccaacctgagccgcaactgggtgatgatcccgcac
gtgactcacttcgacaaaaccgatatcaccgatctggaagcgttccgcaagcagcagaac
gacgaagctgccaagcgtaagctggacgtgaagttcaccccggtggtgttcatcatgaaa
gccgttgccgctgccctggagcagatgccacgcttcaacagctcactgtccgaagatggc
cagaagctgacgctgaagaaatacatcaacatcggcgtggcggtagatacgccaaatggc
ctggtggttccggtattcaaggatgtgaacaagaagagcatcactgagctgtcccgtgaa
ctgatggcgatctccaaaaaagcgcgtgacggtaagttgaccgcaggcgaaatgcagggc
ggttgcttcaccatctccagcctgggcggtatcgggactactcacttcgcgccgattgtt
aacgcgccggaagtggctatcctgggtgtctccaagtctgcgatggagccggtctggaac
ggtaaagagttcacgccgcgcctgatgatgccaatgtcgctctccttcgaccaccgtgtg
attgacggtgctgacggtgcgcgctttatcaccatcatcaacaacatgctggccgacatt
cgccgtctggtgatgtaa

DBGET integrated database retrieval system