KEGG   Sinorhizobium fredii HH103: SFHH103_00189Help
Entry
SFHH103_00189     CDS       T01731                                 

Gene name
fadA
Definition
(GenBank) fadA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00071  Fatty acid degradation
sfh00072  Synthesis and degradation of ketone bodies
sfh00280  Valine, leucine and isoleucine degradation
sfh00310  Lysine degradation
sfh00362  Benzoate degradation
sfh00380  Tryptophan metabolism
sfh00620  Pyruvate metabolism
sfh00630  Glyoxylate and dicarboxylate metabolism
sfh00640  Propanoate metabolism
sfh00650  Butanoate metabolism
sfh00900  Terpenoid backbone biosynthesis
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
sfh01130  Biosynthesis of antibiotics
sfh01200  Carbon metabolism
sfh01212  Fatty acid metabolism
sfh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SFHH103_00189 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    SFHH103_00189 (fadA)
   00640 Propanoate metabolism
    SFHH103_00189 (fadA)
   00650 Butanoate metabolism
    SFHH103_00189 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SFHH103_00189 (fadA)
   00072 Synthesis and degradation of ketone bodies
    SFHH103_00189 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFHH103_00189 (fadA)
   00310 Lysine degradation
    SFHH103_00189 (fadA)
   00380 Tryptophan metabolism
    SFHH103_00189 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SFHH103_00189 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SFHH103_00189 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SFHH103_00189 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfh04147]
    SFHH103_00189 (fadA)
Enzymes [BR:sfh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SFHH103_00189 (fadA)
Exosome [BR:sfh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFHH103_00189 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C TRI9
Motif
Other DBs
NCBI-ProteinID: CCE94693
UniProt: G9AAR3
Position
complement(196686..197894)
Genome map
AA seq 402 aa AA seqDB search
MTKVFVYDHVRTPRGRGKKDGSLHEVPSVRLAAKVLEAVRDRNGLDTSSVDDIVMGCVDP
VMDAGSVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGSWFMDPSVSLPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAAHA
WEKGYFANSVVPVKDQNGLTILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVAIQA
HPEIERINYVHHAGNSSGIVDGAAAVLLGSKAGGEAMGLKPRARIRAFANIGSDPALMLT
GPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRYMQAFDIPHDQINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtcttcgtttacgaccacgtgcgcacgccgcgcggccgtggcaagaaggac
ggctcgctgcatgaagtgccgtccgtccggctcgccgccaaggtgctcgaggcggtccgc
gaccgcaatgggctcgacacctcgagcgtcgacgacatcgtcatgggctgcgtcgatccg
gtcatggatgccggctcggtgatcccgaaggcggcggccttcgaagcgggctactcgaca
cgggcgccgggcatgcagatctcccgcttctgcgcctccggcctcgacgccgtcaatttc
ggcgctgccaagatcgcccaaggggcggacgacatcgtcattgccggcggcgtcgagtcg
atgtcgcgggtcggcctcggcatgtcgggcggctcctggttcatggatccctccgtcagc
ctgccggcctatttcatgccgcagggcgtctcggccgacctgatcgccaccaaatacggc
ttctcgcgcgacgacgtcgacgcctatgcggttgagagccagaagcgcgccgcccatgcc
tgggaaaagggctatttcgcgaattcggtcgtgccggtcaaggaccagaacggcctgacg
atcctcgaccgcgacgagcatatgcgccccggcaccgacatgcaggcgctcgcctcgctc
aacccctccttccagatgccgggcgagatgggcggcttcgaggccgtcgccatccaggcg
catccggaaatcgagcggatcaactatgtccaccacgccggcaattcgtccggcatcgtt
gatggcgccgcggcggtgctgctcggctcgaaggccggcggcgaagccatggggctgaag
ccgcgtgcccgcatccgggctttcgccaatatcggctccgatccggcgctgatgctgacc
ggcccggtcgacgtcacggaaaagctgctgaagcgcgccgacatgaagctttcggacatc
gatctcttcgagctcaacgaggcctttgccgccgtggtgctgcgctacatgcaggccttc
gacattccgcacgaccagatcaacgtcaatggcggcgcgatcgccatgggccatccgctc
ggcgccaccggcgcgatgatcctcggaaccgtgctcgacgagctcgaacgccgcaacctc
aacacggccctggtgacgctctgcatcggcgccggcatgggcaccgccacgatcatcgaa
cgcgtctga

DBGET integrated database retrieval system