KEGG   Sinorhizobium fredii HH103: SFHH103_00662Help
Entry
SFHH103_00662     CDS       T01731                                 

Gene name
dhe
Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00361  Chlorocyclohexane and chlorobenzene degradation
sfh00625  Chloroalkane and chloroalkene degradation
sfh01100  Metabolic pathways
sfh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SFHH103_00662 (dhe)
   00361 Chlorocyclohexane and chlorobenzene degradation
    SFHH103_00662 (dhe)
Enzymes [BR:sfh01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SFHH103_00662 (dhe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 HAD Acid_PPase
Motif
Other DBs
NCBI-ProteinID: CCE95161
UniProt: G9A271
Position
complement(735962..736624)
Genome map
AA seq 220 aa AA seqDB search
MSHAAYVFDAYGTLFDVHAAVRRHAEAIGPDGQAFSELWRAKQLEYSWVRSLMGAYVDFW
QLTEQSLDYAFARFPSADPKLRKPLLDAYWALDCYPEVPAVLKGLKERGARIAILSNGSP
AMLASAVKNAALDIIIDDVFSVDAVKAFKTAPAVYDLVTTQYRLYPHAVSFQSSNRFDIA
GATKFGFRTVWINRADMPDEYKDYGPSLILPSLESLQIGI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatgcggcctatgtcttcgatgcctatggcacgcttttcgacgtccatgcggcc
gtgcgccgacacgccgaggcgatcggcccggacggccaggctttctccgaactctggcgc
gccaagcagctcgaatattcctgggtgcgctcgctgatgggcgcctatgtcgatttctgg
caattgaccgagcaatcgctggattacgccttcgcccgcttcccgtccgccgacccgaag
ctcaggaagccgttgctcgacgcctactgggcgcttgattgctatccggaggtcccggcc
gtgctcaaaggattgaaggagcgtggcgcccgcatcgccatcctctcgaacggctcgccg
gccatgcttgcatcggccgtcaagaatgccgccctcgacatcattatcgacgacgtcttc
tcggtcgatgcggtcaaggccttcaagacggcacccgccgtctacgacctggtgacgacg
cagtatcggctctatccgcatgcggtttcgttccagtcgtcgaatcgcttcgacatcgcc
ggcgctaccaaattcggcttccgcacggtgtggatcaaccgcgccgacatgcccgacgag
tacaaggactatggcccctcgctcatcctgccttcgcttgaaagcctgcaaatcggcatt
tga

DBGET integrated database retrieval system