KEGG   Sinorhizobium fredii HH103: SFHH103_01026Help
Entry
SFHH103_01026     CDS       T01731                                 

Gene name
pyrB
Definition
(GenBank) probable aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00240  Pyrimidine metabolism
sfh00250  Alanine, aspartate and glutamate metabolism
sfh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SFHH103_01026 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFHH103_01026 (pyrB)
Enzymes [BR:sfh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SFHH103_01026 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CCE95525
UniProt: G9A4N1
Position
complement(1116069..1117010)
Genome map
AA seq 313 aa AA seqDB search
MITFPHRHLLGIKGLTEQDITLLLDRADEAVKISRQREKKTSSLRGLTQINLFFEASTRT
QSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMHPDVLVVRHASAGAAALLA
QKVSCSVVNAGDGQHEHPTQALLDALTIRRAKGKLSRIIVAICGDVLHSRVARSNILLLN
QMGARVRVVAPATLLPAGIEQMGAEVYRSMAEGLKDADVVMMLRLQRERMAGSFVPSVRE
YFHYYGLDAEKLKAAKDDALVMHPGPMNRGVEIASEIADGPQSVIEQQVEMGVAVRMAVM
ETLLLSQDQGPRP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcactttcccgcatcgccacctgcttggcatcaaggggctgacggaacaggacatc
acgctcctgctcgatcgggccgacgaagccgtgaagatctcccggcagagggagaaaaag
acctcgtcgctgcgcggactgacgcagatcaacctcttcttcgaggcgtcgacccgcacg
caatcctccttcgaactggctggcaaacggctcggcgccgacgtcatgaacatgtcggtc
ggcaactcctcggtgaagaagggggagacgctgatcgacacggcgatgacgctgaatgcg
atgcacccggacgtgctcgtcgtgcgccacgcgtcggccggcgccgcggcactgctcgcg
cagaaggtctcctgctcggtcgtcaacgccggcgacggccagcacgagcatccgacgcag
gcactcctcgacgcgctgacgatccgccgcgccaagggcaagttgtcgcggatcatcgtg
gcgatctgcggcgacgtcctgcactcgcgtgtcgcccgctccaacattctgcttctcaac
cagatgggcgcccgcgtccgtgtcgtcgcgccggcgaccttgctccccgccggcatcgaa
cagatgggtgccgaggtctatcgctccatggcggagggcctgaaggatgccgacgtggtg
atgatgctgcgcctccagcgcgagcgcatggccggctccttcgtcccatcggtgcgcgag
tatttccactattacgggctcgacgcggaaaagctgaaagccgctaaggatgatgcgctc
gtcatgcatccaggaccgatgaaccgcggcgtcgagatcgcctcggagatcgccgacgga
ccgcaaagcgtcatcgaacagcaggtcgagatgggcgtcgcggtgcgcatggccgtcatg
gaaacacttcttctctcgcaggaccaggggccgcgcccatga

DBGET integrated database retrieval system