KEGG   Sinorhizobium fredii HH103: SFHH103_01170Help
Entry
SFHH103_01170     CDS       T01731                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00010  Glycolysis / Gluconeogenesis
sfh00020  Citrate cycle (TCA cycle)
sfh00620  Pyruvate metabolism
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
sfh01130  Biosynthesis of antibiotics
sfh01200  Carbon metabolism
Module
sfh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_01170
   00020 Citrate cycle (TCA cycle)
    SFHH103_01170
   00620 Pyruvate metabolism
    SFHH103_01170
Enzymes [BR:sfh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SFHH103_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 DUF2118 QRPTase_N GCV_H ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: CCE95668
UniProt: G9A524
Position
1252426..1253754
Genome map
AA seq 442 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAADGEDVATAAKGGNGAAAPASAAKAEAAAPAAPAASPAPAAA
PAAPAQAAGEGKRVFSSPLARRLAKEAGIDLSAIAGSGPYGRVVKKDVESAVSGGTAKPA
AAPAAAQAPAAAPLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLQESKQTIPHFYV
SLDCQLDALLALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSWTDTNM
VKHKHADVGVAVSIPGGLITPIIRQAELKSLSAISNEMKDYGKRAKERKLKPEEYQGGTT
AVSNMGMMGVKNFAAVVNPPHATILAVGAGEERVIVKNKEMVVANMMTVTLSTDHRCVDG
ALGAELLGAFKRYIENPMGMLV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcacaatgcctgccctctcgccgaccatggaagaaggcaatctcgcc
aagtggctggtcaaggaaggcgacaaggtcaagtccggcgacgtcatcgccgagatcgaa
actgacaaggcgacgatggaagtcgaagccgtcgatgagggcaccgtcgccaagatcgtc
gttccggccggcaccgaaggcgtcaaggtcaatgccttgatcgcggttctggccgcggac
ggcgaggacgtcgcaaccgcggccaagggcggcaatggcgctgccgcgccggcgtccgcc
gccaaggcggaagcagctgctcctgcagcgcccgccgcgtcacctgcaccggccgcagcc
cccgctgctccggcacaggctgcgggtgagggcaaacgcgtcttctcctcgcccctggcc
cgtcgtcttgccaaggaagcgggcatcgacctctccgcaattgccggttccggcccttac
ggccgcgtcgtcaagaaggatgtggaatctgcggtctccggcggcacggccaaaccggcc
gcagcaccggctgccgctcaggcaccggccgcggcaccgctcgccaagggcatgtccgag
gatgccgtcctgaagctcttcgagccgggctcctacgagctcgtcccgcatgacggcatg
cgcaagacgattgccaagcgcctgcaggaatcgaagcagacgatcccgcacttctacgtc
tctctcgattgccagctcgatgcgctgctggcgctgcgtgcccagctcaatgcggctgcc
cccgaaaaggacggcaagccggtttacaagctctcggtcaatgacatggtgatcaaggcg
ctggcgctggcgctgcgtgacgttccggatgcgaacgtctcctggaccgacacgaacatg
gtcaagcacaagcacgccgatgtcggcgttgctgtgtcgatcccgggcgggctgatcacg
ccgatcatccgccaggcggagttgaagagcctttcggccatctccaacgagatgaaggac
tacggcaagcgcgccaaggagcgcaagctgaagcccgaggaataccagggcggtaccacg
gcggtttccaatatggggatgatgggcgtcaagaacttcgcggccgtcgtcaacccgccg
catgcgacgatcctcgcggtcggtgccggcgaggaacgggtcatcgtcaagaacaaggag
atggtcgtcgccaacatgatgaccgtcacgctctcgaccgaccatcgctgcgtcgatggt
gcgctcggcgccgaactgctcggggccttcaagcgctacatcgaaaacccgatgggcatg
ctcgtctga

DBGET integrated database retrieval system