KEGG   Sinorhizobium fredii HH103: SFHH103_01280Help
Entry
SFHH103_01280     CDS       T01731                                 

Definition
(GenBank) K00118 glucose-fructose oxidoreductase
  KO
K19181  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming) [EC:1.1.1.292]
Organism
sfh  Sinorhizobium fredii HH103
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SFHH103_01280
Enzymes [BR:sfh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.292  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming)
     SFHH103_01280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C
Motif
Other DBs
NCBI-ProteinID: CCE95778
UniProt: G9A5V0
Position
complement(1372882..1373964)
Genome map
AA seq 360 aa AA seqDB search
MGCEIARRAVLSHSARKPTTRGTMAVRQNAEEGWSVMGTGTIATEHMVAAIRAMGHSPLW
VVSKSRADAIHFSNDLGIPQATTDLERVWSDPAVKFVYISASLKRRQHYVLAAADAGKHI
LCDGPLSEDSKTAKRLDKHCADSGVVLAVNQPLRASAIHQTMRRLVLEGEIGSIQSLSIL
RGGPFQPPPNRRGEMPHNGGNVYLDVCAEDIDLARFLTGAEPVEAIAFARESNGSPNHLA
YTIRMDDGGLLQAHESFGTADIESMVVAAGTDGVLIASGTLSSRGSGVLVRRLAGRNELV
PVRERDLHTATLEEFVGAARNEASPLATGMDSFASLVATEAVASAARTGRATAIRPGESA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggatgcgaaattgcccggcgagcggtcctgtcgcacagtgcccgaaagccgacaacg
cgaggcaccatggcagtgcgacagaacgccgaggagggatggtccgttatggggaccggg
acgatcgcaaccgagcacatggtcgcggccatccgtgcgatggggcattcgccgctttgg
gtggtgagcaaaagccgagcagatgccatccatttctccaatgatttgggtattccccag
gcgacgacagacttggagcgcgtgtggtccgatccggcagtcaagttcgtctacatcagc
gcctctctcaagcgtcgccaacattacgttctggcggcggccgatgccggaaagcacatc
ctctgcgatggcccgctatcggaagacagcaaaaccgcaaagaggctcgacaagcactgc
gcggacagtggagtggtgctcgcagtcaaccagccccttcgtgcttcggctattcaccag
acgatgcgccgattggttctcgaaggagagatcgggtcgatacagtctctatcgatcttg
cgcggcgggccctttcagccccctccaaatcggaggggggagatgccccacaacggcgga
aacgtctatctcgacgtctgcgccgaagacatcgatctcgcgcgctttcttaccggtgct
gagccggtcgaggcgattgccttcgcaagggaatcgaacggctcgcccaaccatctcgct
tatacaattcgtatggatgatggcggccttctccaggcgcatgagagtttcggcacagcc
gacattgaaagcatggtcgtggcagccggcaccgacggcgtgctgattgcaagcggtaca
ttgagctcgcgcggctccggcgttctggtgcgtcggctcgcaggccgtaacgagctcgtt
cccgtgcgtgaacgagatctgcacaccgccacattggaagagtttgtcggcgcggcgaga
aatgaagcttccccactggcgactggcatggacagtttcgcgtcgctggtcgctaccgaa
gcagtggcttcggcagcaagaacagggcgagcgacggcgatccgaccaggtgagagtgca
tga

DBGET integrated database retrieval system