KEGG   Sinorhizobium fredii HH103: SFHH103_01334Help
Entry
SFHH103_01334     CDS       T01731                                 

Definition
(GenBank) probable isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00630  Glyoxylate and dicarboxylate metabolism
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
sfh01200  Carbon metabolism
Module
sfh_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SFHH103_01334
Enzymes [BR:sfh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SFHH103_01334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CCE95832
UniProt: G9A6F2
Position
complement(1436322..1438070)
Genome map
AA seq 582 aa AA seqDB search
MGRDIFRAFPCLITTLQNWLVKFDNSTLQALQSPRKSAYAFAYATLTSSEEIMSYEAYLD
EASRLIKDNGNWSGITAESVARMRLQNRFRTGLDIARYTASIMRRDMAAYDKDPGKYTQS
LGCWHGFIAQQKVISLKKHFGSTERRYLYLSGWMVAALRSEFGPLPDQSMHEKTSVPALV
EELYTFLRQADARELATLFREIDKARSAGDTVREQQLTQAVNNHQTHVIPIIADIDAGFG
NAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDGKVTVPHEEFVAKIRACRYAFLEL
GVDDGIIVARTDSLGAGLTKQIAFSASEGDIGDQYNSFLDCEDVTDQKPSNGDVLITRGS
RVLRPKRLRSNLYQFREGTGVDRCVLDCINAIRNGADLLWIETEKPHVEQIAGMMDRIRD
VIPDAKLVYNNSPSFNWTLNFRQQIFDAWQRDGKDVSGFDRARLMSEEYDGSELAREADE
RIRTFQRDASKRAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVANVQRKEIRQG
IACVKHQNMAGSDIGDDHKDYFAGEAALKAGGEHNTMNQFAA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgggccgagatatattccgagcttttccatgcctcattacaacattacaaaattggctt
gtaaagtttgacaactcgacactgcaagcgcttcagagtccaaggaagagcgcctatgcc
ttcgcctacgcaacactgacatcctcggaggaaatcatgtcctatgaagcttacctcgat
gaagcatcccgcctgatcaaggacaacggcaactggagcggcataaccgccgaatcggtt
gcccgcatgcgtctgcagaaccgcttcaggaccggattggacatcgcgcgctacacggct
tccatcatgcgccgggacatggccgcctatgacaaggatccgggcaagtacacccagtcg
ctcggttgctggcacggcttcatcgcacagcagaaggtcatctccctgaagaagcacttc
ggctcgacggaacggcggtacctctacctttccggttggatggttgcggcgcttcgctcc
gagttcggtccgcttccggaccaatccatgcatgagaagaccagcgttccggcgctggtc
gaggagctttacactttccttcgccaggccgatgcgcgcgagctcgccacattgttccgg
gagatcgacaaggcccgctcggccggtgacacggtgcgcgaacagcaactcacccaagcg
gtcaacaatcaccagacgcacgtcatcccgatcatcgccgacatcgatgcgggcttcggc
aacgcagaggcgacgtatctgctcgccaagaagatgatcgaagccggcgcctgcgcgctc
cagatcgagaaccaggtttccgacgaaaaacaatgcggccatcaggacggcaaggtaacc
gttcctcacgaggagttcgtcgccaagatccgggcatgccgttacgcgtttctcgaactc
ggcgtcgacgacggcatcatcgtcgcgcgaaccgactcgctcggtgcgggtctaacgaaa
cagatcgccttcagtgccagcgaaggtgacatcggcgaccaatacaactcgttcctggat
tgcgaggacgtcacggatcaaaagccgtccaatggagacgtcttgatcaccagagggtcg
agggtcctgcggcccaagcggctgaggtcaaatctctaccagttccgggaaggcacgggt
gtcgaccgctgcgtcctggattgcatcaacgcaatcaggaacggcgccgaccttctctgg
atcgagacggagaagccgcatgtcgagcagatcgccggaatgatggaccgtatccgcgac
gtcatcccggatgcgaagctcgtctacaacaactctccatcgttcaactggacgctgaac
ttccgccagcagatcttcgacgcctggcagagggacggcaaggacgtctccggcttcgac
agggcgaggctgatgagcgaggagtacgacggcagtgaactggcgcgcgaggctgacgag
cgcatccgcaccttccagcgcgacgcctcgaagcgggccggcatcttccatcacctcatc
accttgccgacctaccacaccgccgcgctttccaccgacaatctcgccaaggagtacttc
ggtgaccagggcatgctcggctacgtcgccaacgtgcagcgcaaggagatccgacagggc
atcgcctgcgtgaagcaccagaacatggccggctccgacatcggtgacgaccacaaggat
tatttcgccggcgaagccgccctcaaggctggtggcgagcacaacaccatgaaccagttc
gccgcctga

DBGET integrated database retrieval system