KEGG   Sinorhizobium fredii HH103: SFHH103_02227Help
Entry
SFHH103_02227     CDS       T01731                                 

Gene name
fhs
Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00670  One carbon pool by folate
sfh01100  Metabolic pathways
sfh01120  Microbial metabolism in diverse environments
sfh01200  Carbon metabolism
Module
sfh_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SFHH103_02227 (fhs)
Enzymes [BR:sfh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SFHH103_02227 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: CCE96722
UniProt: G9A8Z2
Position
complement(2385966..2387645)
Genome map
AA seq 559 aa AA seqDB search
MPEVKSDIEIARAARKQPIMEIGAKLGIPPEHLLPYGHDKAKVSAEFIAAQKGKRSGRLI
LVTAINPTPAGEGKTTTTVGLGDGLNRIGKKTIVCIREASLGPCFGIKGGAAGGGYAQVV
PMEDINLHFTGDFHAITSAHNLLAALIDNHIYWGNEQAIDIRRIAWRRVMDMNDRALRQI
IGSLGGVANGYPRETGFDITVASEVMAILCLAADIRDLEKRLGNIIIGYRRDKSPVYARD
IKADGAMAVLLKDAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVVATTTALKLADYVVT
EAGFGADLGAEKFFDIKCRKAGLKPDAAVVVATVRAIKMNGGVKKDDLGKENLEALRKGC
ANLGRHVQNVKKFGVPVLVAINHFTSDTEAEIQAIKDYVRTLGSEAVLCRHWAEGSAGIE
ELAHKVVDLANAGHSQFSPLYPDDMPLFHKIETIAKDIYHANEVIADKLVREQLRTWEDQ
GYGHLPICMAKTQYSFSTDPNLRGAPSGHAVPIREVRLAAGAGFVVVITGEIMTMPGLPK
VPSSERIHLNEAGYIEGLF
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggtcaagtccgatatcgagatcgcgcgtgctgcgcgcaagcaaccgatcatg
gagatcggcgcgaaactcggcatcccgccggaacatctgcttccctacggccatgacaag
gcgaaggtgagtgccgaattcatagcggcgcagaaggggaagagaagcggccggctgatc
ctcgtgacggcgatcaacccgacgccggccggcgagggcaagacgacgaccaccgtcggc
ctcggcgacgggctcaatcgcatcggcaagaagacgatcgtctgcatccgcgaggcctcg
ctcggcccctgcttcggcatcaagggcggtgcggctggcggcggttacgcccaggtcgta
ccgatggaggacatcaacctacatttcaccggcgatttccatgccatcacctcggcgcac
aacctgctcgccgcgctgatcgacaaccatatctactggggcaacgaacaggccatcgac
atccgccgcatcgcctggcggcgggtgatggacatgaacgaccgggcactgcgccagatc
atcggctcgctcggcggcgtcgcaaacggctatccgcgtgagacgggcttcgacatcacc
gtcgcctcggaggtcatggcgattctttgcctcgccgccgatatcagggacctcgaaaaa
cgcctcggcaacatcatcatcggctaccggcgcgacaagagcccggtctacgcccgggac
atcaaggcggacggggcgatggcggtcctgctcaaggatgcgatgcagccgaacctggtg
cagacactcgagaacaacccggccttcgtccatggcggccccttcgccaacatcgcgcat
ggctgcaattcggtcgtggcgacgacgacggcgctgaagcttgccgactatgtggtgaca
gaagcgggcttcggtgcggatctcggcgcggaaaaattcttcgacatcaagtgccgcaag
gccggcttgaagccggacgcggccgtcgtcgttgccaccgtcagggcaatcaagatgaat
ggcggcgtgaagaaggacgacctcggcaaggagaatctcgaggcgctcaggaaaggatgc
gccaatctcgggcgccatgtgcagaacgtcaagaaattcggcgtgccggtgctcgtcgcg
atcaatcacttcacctccgatacggaggccgagatccaggcgatcaaggattatgtccgc
acgctcggttccgaagccgtcctgtgccggcactgggctgagggctcggccggcatcgag
gaattggcgcacaaggtcgtcgatctggccaatgcgggacactcacagttctcgccgctt
tatccggacgacatgccgctcttccacaagatcgagacgatcgccaaggacatctaccac
gccaatgaagtcattgccgacaagctggtgcgggagcaactcaggacctgggaagaccag
ggctacgggcacctgccgatctgcatggcgaaaacccaatattccttctccaccgacccc
aatctgcgcggcgccccgagcggccatgcggtgccgatccgcgaagtccgccttgcggcc
ggcgccggcttcgtcgtcgtcatcacgggcgagatcatgacgatgccgggcctgccgaag
gtgccgtcttcggaaaggatccacctcaatgaagcaggctacatagagggcttgttctga

DBGET integrated database retrieval system