KEGG   Sinorhizobium fredii HH103: SFHH103_02303Help
Entry
SFHH103_02303     CDS       T01731                                 

Gene name
rfbC
Definition
(GenBank) putative dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00521  Streptomycin biosynthesis
sfh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SFHH103_02303 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SFHH103_02303 (rfbC)
Enzymes [BR:sfh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SFHH103_02303 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CCE96798
UniProt: G9A968
Position
2476239..2476772
Genome map
AA seq 177 aa AA seqDB search
MSRFNRLPTPLAGLVVIERKQLGDERGFFSRFFCRDELRDFGADGSIAQINHTSTRNKGT
IRGMHFQRPPHDETKFVSCLSGAVFDVAVDIRPDSPTYLQWHGEILSAENARSMMIPGGF
AHGFQTLTADCELLYLHDKPYAPGAEGGLNPLDPRLAIAWPLDVTQMSERDRAFSLL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcttcaatcgcctccccacccctcttgccggtctggtcgtcatcgagcgtaag
cagctaggcgacgagcgcggcttcttctcgcgcttcttctgccgcgacgagctacgtgat
ttcggcgccgacggttcgattgcgcagatcaaccacacttcgacgcgcaacaagggaacg
atccgcggcatgcacttccagcggccgccgcacgacgagacgaaattcgtctcctgcctt
tcgggcgccgtcttcgacgtagccgtcgacatcaggccggattcgccgacctatctccaa
tggcacggcgagatcctcagcgccgaaaacgcccgctcgatgatgatcccgggtggcttc
gcccatggattccagacgctgacggcggactgcgagctcctctacctgcacgacaaacct
tacgcgccgggcgcggaaggcgggctcaacccgctcgacccgcgcctcgccatcgcctgg
ccgctcgacgtgacgcagatgtccgagcgcgatcgcgcctttagcttgctctaa

DBGET integrated database retrieval system