KEGG   Sinorhizobium fredii HH103: SFHH103_03168Help
Entry
SFHH103_03168     CDS       T01731                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00020  Citrate cycle (TCA cycle)
sfh00190  Oxidative phosphorylation
sfh00650  Butanoate metabolism
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
sfh01130  Biosynthesis of antibiotics
sfh01200  Carbon metabolism
Module
sfh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sfh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SFHH103_03168 (sdhD)
   00650 Butanoate metabolism
    SFHH103_03168 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SFHH103_03168 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CCE97660
UniProt: G9A295
Position
complement(3432592..3432972)
Genome map
AA seq 126 aa AA seqDB search
MDMRTPLGKVRGLGSAKEGTDHFWRQRLTAVANLPLLIFFVFFVARYAGAPHAEVVAALA
NPFVAVIMALVVTSALVHMRIGMQVIIEDYVHAEGAKIALLMLNTFFAIAIGGLCLFAVL
KIAFAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggacatgcgcacacccctcggaaaggttcgcggtctcggctcggccaaggagggtacg
gaccacttctggcgccagcgcctgacggccgtcgccaaccttccgctcttgatcttcttc
gtcttcttcgtggcccgctatgccggtgcgccgcatgcggaagtcgtcgccgccctcgcc
aatccgttcgtcgcggtgatcatggctctcgtcgtgacctcggcgctcgtccacatgcgg
atcggcatgcaggtcatcatcgaagactacgtccatgcggagggcgccaagatcgcgctt
ctcatgctcaatacattctttgcgatcgcgatcggcgggctctgtcttttcgccgtcctg
aagatcgcttttgcagggtaa

DBGET integrated database retrieval system