KEGG   Sinorhizobium fredii HH103: SFHH103_03481Help
Entry
SFHH103_03481     CDS       T01731                                 

Gene name
acsa5
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00010  Glycolysis / Gluconeogenesis
sfh00620  Pyruvate metabolism
sfh00640  Propanoate metabolism
sfh00680  Methane metabolism
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
sfh01130  Biosynthesis of antibiotics
sfh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_03481 (acsa5)
   00620 Pyruvate metabolism
    SFHH103_03481 (acsa5)
   00640 Propanoate metabolism
    SFHH103_03481 (acsa5)
  Energy metabolism
   00680 Methane metabolism
    SFHH103_03481 (acsa5)
Enzymes [BR:sfh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SFHH103_03481 (acsa5)
Lipid biosynthesis proteins [BR:sfh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SFHH103_03481 (acsa5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCE97972
UniProt: G9A3M4
Position
complement(3781589..3783538)
Genome map
AA seq 649 aa AA seqDB search
MDVKTYPVLEAAKNRTLVDNATYLKWYEESVADPEAFWGEHGKRIEWFEPYTEVKNTSFE
GNVSIKWFEDGLTNVSYNCIDRHLKTHGDKTAIIWEGDNPYIDKKITYNELYDKVCRLAN
VLKKHGVQKGDRVTIYMPMIPEAAYAMLACARIGAIHSVVFGGFSPEALAGRIVDCESTF
VITCDEGLRGGKPVPLKENTEKAIDIAARQYVMVNKVLVVRRTGGKVPWAPGRDAWYHQE
IATVEPHCPPEKMSAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHDGDI
YWCTADVGWVTGHSYIVYGPLANAATTLMFEGVPNFPDAGRFWEVIDKHKVNIFYTAPTA
IRSLMGAGDDFVKRSSRSSLRLLGTVGEPINPEAWEWYYHVVGEERSPIVDTWWQTETGG
ILITPLPGATDLKPGSATRPFFGVQPQIVDNEGNVIDGPADGNLCIIDSWPGQMRTVYGD
HERFIQTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVLNVSGHRLGTAEVESALVSHH
LVSEAAVVGYPHPIKGQGIYCYVSLMAGEVGSDELRQELVKHVRSEIGPIATPDKIQFAP
GLPKTRSGKIMRRILRKIAEDDFGSLGDTSTLADPAVVDDLIANRQNRG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcaagacctatccggtcctggaagcggccaagaaccgcacgcttgtcgacaac
gcgacctatctgaaatggtatgaggagagcgttgccgatccggaggcgttctggggtgaa
catggcaaacggatcgaatggttcgagccctataccgaggtcaagaatacgtccttcgag
ggcaatgtttcgatcaagtggttcgaggacgggctgaccaacgtctcctacaattgcatc
gatcgccacttgaagacgcatggcgacaagaccgcaatcatctgggaaggcgacaatccc
tacatcgacaagaagatcacctacaacgagctctacgacaaggtttgccggcttgccaac
gtgctcaagaaacatggcgtccagaaaggcgaccgcgtcaccatctacatgccgatgatc
ccggaagcggcctatgcgatgctcgcctgtgcccgcatcggcgccatccactcggtggtt
ttcggtggcttctcgccggaagcgctggccggccgcatcgtcgactgcgaatcaaccttc
gtgatcacctgcgacgagggcttgcgcggcggcaagccggtgccgctcaaggaaaacact
gaaaaggcgatcgacatcgctgccaggcaatatgtcatggtcaacaaggtcctggtcgta
cgccgcaccggcggcaaggtgccatgggcaccgggccgcgacgcctggtaccatcaggag
atcgccacggtcgagccgcattgcccgccggagaagatgagcgccgaggatccgctgttc
atcctctatacctccggttcgaccggcaagccgaagggcgtgctgcacacgaccggcggc
tatctcgtctacgcctcgatgacgcatcaatatgtcttcgactatcacgacggcgacatc
tactggtgcacggccgatgtcggctgggtcaccggccactcctatatcgtctacgggccg
ctcgccaacgccgcgacgacgctgatgttcgagggcgtgccgaacttcccggatgccggc
cgtttctgggaggtcatcgacaagcacaaggtcaatatcttctacaccgccccgacggcg
atccgctcgctgatgggcgccggcgacgacttcgtcaaacgctcgtcgcgctcgtccctg
cgtctgctcggcaccgtcggcgagccgatcaatccggaagcctgggaatggtactaccac
gttgtcggcgaggagcgctcgccgatcgtcgatacctggtggcagacggagaccggcggc
atcctgatcacgccgctgccgggcgccaccgatctgaagcccggttcggcgacgcggccc
ttcttcggcgtccagccgcagatcgtcgacaatgaaggcaacgtgatcgacggcccggcc
gacggcaatctctgcatcatcgacagctggccgggccagatgcgcaccgtctatggcgac
cacgagcgcttcatccagacctatttctcgacctacaagggcaagtacttcaccggcgac
ggctgccggcgcgatgcggacggctattactggatcaccggccgcgtcgatgacgtgctc
aatgtctctgggcatcgtctcggtacggcggaagtggagtcggctttggtgtcgcaccac
ctcgtttccgaggctgcggtggtcggttatccgcatccgatcaagggacagggcatttac
tgctatgtgtcgctgatggcgggggaggtcggcagcgacgagctgcgccaggaactcgtc
aagcatgtgcgttcggagatcgggccgatcgccacgccggacaagatccagttcgccccc
ggcctgccgaagacgcgctccggcaagatcatgcgccggattctgcgcaagatcgccgaa
gacgatttcggttcgctgggcgacacgtcgacgctcgccgatccggcggtcgtcgacgac
ctgatcgccaaccgccagaaccgcgggtaa

DBGET integrated database retrieval system