KEGG   Sinorhizobium fredii HH103: SFHH103_05681Help
Entry
SFHH103_05681     CDS       T01731                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00430  Taurine and hypotaurine metabolism
sfh00620  Pyruvate metabolism
sfh00640  Propanoate metabolism
sfh00680  Methane metabolism
sfh01100  Metabolic pathways
sfh01120  Microbial metabolism in diverse environments
sfh01200  Carbon metabolism
Module
sfh_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SFHH103_05681 (ackA)
   00640 Propanoate metabolism
    SFHH103_05681 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    SFHH103_05681 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SFHH103_05681 (ackA)
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SFHH103_05681 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: CCF00144
UniProt: G9AGG2
Position
pSfHH103e:complement(886762..887946)
Genome map
AA seq 394 aa AA seqDB search
MDALLVVNAGSSSLKFQVFGIAEVGLTRQVRGQIGGIATRPRLQAKGADGSVLVDQSYAA
EAVRDLPAAIAAAREWLLTLEGLELRAIGHRVVHGGPDYAQPVLIDATVLDRLASYQDLA
PLHQPNNLAPIRLAMEINPDVPQVACFDTAFHRGHPEHADCYALPRALYDQGVRRYGFHG
LSYEYIAERLHEIAPEAAGGKVIVAHLGSGASMCALRDGHSVESTMGFTALDGLPMGTRP
GQLDPGVVLYLISEKGMSADAVSDLLYHEAGLKGLSGISNDMRELLASDDPRAAFAIAHF
VHRCRLNLGMLAAALGGVDAFVFTAGVGENSAPIRARIAEGLTWLGAELDPAANDAGGAL
ISTATSRVALHVIPTDEELMIARHTLALVNTHQA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgctccttgtcgtcaatgccggttcgtccagcctgaagttccaggtcttcggc
atagctgaggtgggcctgacgcgccaggtacgcggccaaatcggcggcatcgctacgcga
ccgcgcctgcaggcaaagggtgcagacggaagcgtgcttgtcgatcagagttacgccgcg
gaagccgttcgcgaccttccggccgccatcgcggcagcgcgcgaatggctgctgacgctc
gaggggcttgaactgcgcgcgatcggccatcgcgtcgtgcatggtgggccggactatgca
cagcctgtgctgatcgatgcgaccgtgctcgaccgtctggccagctaccaggatctggca
cccctgcaccagccgaacaatctggcgccgatccggctcgccatggaaatcaatcccgac
gtaccgcaggtcgcctgcttcgatacggccttccaccgcgggcatccggagcacgccgat
tgctacgcgttgccgcgggcgctctatgatcagggcgtgcggcgttacggcttccacggg
ctttcctacgaatacatcgccgagcggctgcacgagatcgccccggaagcagccggcggc
aaggttatcgtcgcgcatctcggcagcggcgcgtcgatgtgcgcgctgcgcgacggccac
agcgtcgagagcacaatgggcttcacggcgctcgatggcctgccgatgggaacacggccg
ggccagctcgacccgggcgtcgtgctctatctcatctcggagaagggcatgagtgccgac
gccgtctcggacctcctctaccatgaggccggtctcaagggtctttccggaatctcgaac
gatatgcgcgaacttctggcaagcgacgatccgcgcgccgccttcgccatcgcccatttc
gtccatcgctgcaggctcaacctggggatgctcgcggcggcgctgggcggggtcgacgca
ttcgtcttcacggcgggcgtcggcgaaaattccgcgccgatccgcgcccggatcgccgaa
ggcctcacctggcttggcgccgaactcgacccggcggcgaacgacgccggcggcgcgctg
atttcgaccgccaccagccgcgttgcacttcatgtcatcccgaccgacgaggaactgatg
atcgcgcgccatacgctggcgctggtcaacacccatcaagcctga

DBGET integrated database retrieval system