KEGG   Streptomyces fulvissimus: SFUL_1422Help
Entry
SFUL_1422         CDS       T02650                                 

Definition
(GenBank) Inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sfi  Streptomyces fulvissimus
Brite
KEGG Orthology (KO) [BR:sfi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SFUL_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2070
Motif
Other DBs
NCBI-ProteinID: AGK76391
UniProt: N0CJR9
Position
1600515..1601777
Genome map
AA seq 420 aa AA seqDB search
MEHITLLLAIVVVTALVFDFTNGFHDTANAMATTISTGALKPKTAVAMSAVLNLIGAFLS
VEVAKTISGGIVNEDGLRTEVIFAALVGAILWNLLTWLVGLPSSSSHALFGGLIGAAVMS
AGWSSINGGTVVTKVLLPAIAAPLVAGLAAMLATRLTYRINRNVTDPNQLKSTAKGYRAG
QIASAGLVSLAHGTNDAQKTMGIITLALVTGGVLAPGSNPPMWVIVSAGVAIALGTYLGG
WRIIRTMGSGLTDLKPPQGFAAQTSAATVILASSHLGFSLSTTQSCSGAVMGAGLGRKGG
VVRWSTATRMFVAWGLTLPAAGLVGAGAEFLTKQGPWGIAVTATLLVGGSFAIWLASRRQ
PVDHTNVNETAAGDEPQGVVTTAMAAVQTPPIGTIPNDLMTTIPAPATSPDDTARPSATV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaacacatcacgctgctgctcgcgattgtggtcgtgacagctctcgtgttcgatttc
acgaacggtttccacgacaccgccaacgcgatggctaccaccatctcgaccggcgccctg
aagcccaagacagcggtggccatgtccgccgttctcaacctgatcggcgcgttcctgtcg
gtggaggtcgccaagacgatctccggcgggatcgtcaacgaggacggcctcagaaccgag
gtcatcttcgcggcgctcgtcggcgccatcctgtggaatctgctgacctggctggtcggc
ctgccctccagctcctcccacgccctgttcggcggcctgatcggcgccgccgtcatgtcg
gccggctggtcctcgatcaacggcggcaccgtcgtcaccaaggtgctgctgcccgcgatc
gccgccccgctggtcgccggtctcgccgcgatgctggccacgcggctgacgtaccgcatc
aaccggaacgtcaccgacccgaaccagctcaagtcgacggcgaagggctaccgggccggg
cagatcgcctcggccggtctcgtctcgctcgcccacggcaccaacgacgcccagaagacg
atgggcatcatcaccctggccctggtcaccggcggcgtcctcgcccccggctccaacccg
ccgatgtgggtcatcgtctccgccggtgtcgccatcgcgctcggcacctacctcggtggc
tggcgcatcatccgcaccatgggcagcggcctgaccgacctgaagccgccgcagggcttc
gccgcccagaccagtgcggcgaccgtcatcctggcctcctcgcacctcggcttctcgctc
tccaccacccagtcctgctccggcgccgtcatgggcgcgggcctcggccgcaagggaggc
gtggtccgctggtccaccgccacccggatgttcgtcgcctggggtctgacgctcccggcc
gcgggcctggtcggcgcgggtgccgagttcctcaccaagcagggcccctggggcatcgcc
gtcaccgcgaccctgctggtcgggggctccttcgccatctggctggcctcgcgccgccag
ccggtcgaccacaccaacgtcaacgagacggccgctggagacgagccccagggtgtcgtc
accacggccatggccgcggtccagacgccgcccatcggcaccatccccaacgacctcatg
accaccatcccggccccggccacctcgcccgacgacacggcgcggccctcggccacggtg
taa

DBGET integrated database retrieval system