KEGG   Streptomyces fulvissimus: SFUL_4493Help
Entry
SFUL_4493         CDS       T02650                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sfi  Streptomyces fulvissimus
Pathway
sfi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sfi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SFUL_4493
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sfi03011]
    SFUL_4493
Ribosome [BR:sfi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SFUL_4493
  Bacteria
    SFUL_4493
  Archaea
    SFUL_4493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGK79389
UniProt: N0CWQ1
Position
4959269..4959640
Genome map
AA seq 123 aa AA seqDB search
MTHTEGTTMEARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLD
SAIANAAHNYDHPDASSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVSSKE
GTR
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgactcacaccgaagggacaaccatggaagccagggcccaggcgcggtacatccgcgtc
acgcccatgaaggcccgccgagtggtggacctcatccgtggcatggatgccacggaggct
caggcggtcctgcgtttcgccccgcaggccgcgagcgtgccggttggcaaggtgctggac
agcgccattgccaacgctgcacacaactacgaccaccctgacgcctcttcgctggtcatc
agcgaggcgtacgtggacgagggcccgaccctgaagcggttccgaccgcgtgctcagggc
cgtgcctaccggatccgtaagcggaccagccacatcaccgtggtcgtcagcagcaaggaa
ggaacccggtaa

DBGET integrated database retrieval system