KEGG   Streptomyces fulvissimus: SFUL_971Help
Entry
SFUL_971          CDS       T02650                                 

Definition
(GenBank) endoglucanase precursor
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
sfi  Streptomyces fulvissimus
Pathway
sfi00500  Starch and sucrose metabolism
sfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SFUL_971
Enzymes [BR:sfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SFUL_971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: AGK75951
UniProt: N0CII3
Position
complement(1116147..1117436)
Genome map
AA seq 429 aa AA seqDB search
MAAIGSARRRPAEGSSERTNDGAGKGVRGVPGIHGQRRTTHRARRRGARRHGLLAVASAV
VAIGATAGLIEAGQDGRRTTAVPEPTPPPVLQPLPAVPTPTAAPPTASPSAVPTTAPPPS
PRPKVSRTSAAPAATSAAPAPAPRNSLFRDPGSQVVQWVRANPDDPRRPLIESRIAAQPA
AVWFAQYNPGQVAAEVRAVTRGAAAAGRTPVLVPYAIPDRDCGGASQGGAPDGAAYDAWI
REFAEGLGAGPAIVILEPDAIALSDCLTAGARAARFASLARAGATLRAANPKARVYFDGG
HSGWHPAPKQAAALRAAGVTTSGDGIFTNVANFRTTADERAYARQVLAALGGPSNLGAVI
DTSRNGNGAPPPGQWCDPEGRALGQTPTTRTGEDRIDAYLWVKLPGESDGCSAAPGAFSP
EYAHGLATG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggcagccataggctcggcacggcgccgaccggccgaaggttcatcggaacggacgaac
gacggtgccggaaaaggggttcgaggagtgccgggcatacacggacaacgccgcaccacc
caccgggcacgccgtcggggagcccgcaggcacggcctgctggccgtcgcgtcggccgtc
gtggcgatcggggccacggccggcctgatcgaggccgggcaggacgggcgccggaccacg
gccgtcccggagccgacgcctccgccggtcctccagccgctgcccgcggtcccgacgccc
accgccgcgccgccgaccgcgtccccctccgccgtccccacgacggccccgccgccctca
ccgcggcccaaggtctcccgtacgagcgccgcccccgccgcgacatccgcggcccccgcc
ccggcccccaggaacagtctcttccgcgacccggggtcccaggtcgtccagtgggtgcgg
gccaaccccgacgacccgcgccgcccgctgatcgagtcccggatcgcggcgcagccggcg
gcggtctggttcgcgcagtacaacccggggcaggtcgccgcggaggtccgcgccgtcacc
cggggcgcggccgccgccgggcggaccccggtgctcgtcccgtacgccatacccgaccgg
gactgcggtggcgcctcgcagggcggggcgccggacggcgcggcgtacgacgcctggata
cgggagttcgccgaggggctcggcgcgggcccggcgatcgtcatcctggaaccggacgcc
atcgccctctccgactgcctcaccgccggggctcgcgcggcccgcttcgcctcactggcc
cgcgccggagccaccctgcgcgccgccaaccccaaggcccgggtctacttcgacggaggc
cactccggctggcaccccgccccgaagcaggcggccgcgctccgggccgcgggggtgacc
accagcggcgacggcatcttcaccaacgtggccaacttccgcaccaccgccgacgagcgg
gcctacgcccgccaggtgctggccgcactcggcggcccctccaacctcggcgccgtcatc
gacaccagccgcaacggcaacggcgcgcctccgcccggccagtggtgcgaccccgagggc
cgggcgctggggcagacccccacgacgcggaccggcgaggaccggatcgacgcgtacctg
tgggtgaagctgccgggggagtccgacggctgctcggccgcgccgggcgccttctccccg
gagtacgcccacggactggcaaccggctga

DBGET integrated database retrieval system