KEGG   Streptomyces fulvissimus: SFUL_976Help
Entry
SFUL_976          CDS       T02650                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sfi  Streptomyces fulvissimus
Pathway
sfi00010  Glycolysis / Gluconeogenesis
sfi00053  Ascorbate and aldarate metabolism
sfi00071  Fatty acid degradation
sfi00280  Valine, leucine and isoleucine degradation
sfi00310  Lysine degradation
sfi00330  Arginine and proline metabolism
sfi00340  Histidine metabolism
sfi00380  Tryptophan metabolism
sfi00410  beta-Alanine metabolism
sfi00561  Glycerolipid metabolism
sfi00620  Pyruvate metabolism
sfi00625  Chloroalkane and chloroalkene degradation
sfi00903  Limonene and pinene degradation
sfi01100  Metabolic pathways
sfi01110  Biosynthesis of secondary metabolites
sfi01120  Microbial metabolism in diverse environments
sfi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFUL_976
   00053 Ascorbate and aldarate metabolism
    SFUL_976
   00620 Pyruvate metabolism
    SFUL_976
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SFUL_976
   00561 Glycerolipid metabolism
    SFUL_976
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFUL_976
   00310 Lysine degradation
    SFUL_976
   00330 Arginine and proline metabolism
    SFUL_976
   00340 Histidine metabolism
    SFUL_976
   00380 Tryptophan metabolism
    SFUL_976
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFUL_976
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SFUL_976
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SFUL_976
Enzymes [BR:sfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SFUL_976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh TPR_MalT
Motif
Other DBs
NCBI-ProteinID: AGK75956
UniProt: N0CII9
Position
complement(1121540..1122997)
Genome map
AA seq 485 aa AA seqDB search
MSFFTDLAHQYIDGEWRPGKGSWDIIDFNPFNGEKLASIPVATAEEVDQAYRAAERAQQA
WADTNPYARRTVLEKALRIVEEREPQIAEAIVAELGGTHLKAGFELHLAKEFLREAIQLA
LRPAGQILPSPTEGKENRVYRVPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPHQ
NTPICGGTLLAKVFEDAGLPAGLLNVVVTDIAEIGDTLLEHPVPQVISFTGSDKVGRHVA
TVCAANLKRAVLELGGNSALIVLDDADVDYAVDAAVFSRYVHQGQVCMAANRILVDRAIE
EEFTEKFVAKVASLTVGDPADPATQIGPLINSSQAESISRLVDQTVEAGATALLHGRADG
NLVSPSVLTGLAPDSPVLQQEIFGPVALLVPFDGEDEAVRIANDTPYGLSGAVHTANIER
GVRVGQRIHTGMIHINDGTVHDEPIVPFGGEKSSGLGRLNGESMVEAFTTQKWISVQHGR
SQFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcttcactgacctggcccatcagtacatcgacggcgagtggaggccggggaag
gggtcctgggacatcatcgacttcaaccccttcaacggcgagaagctcgcctcgatcccc
gtcgccaccgccgaagaggtcgaccaggcctaccgtgccgccgagcgcgcccagcaggcg
tgggccgacaccaacccgtacgcccggcgcaccgttctggagaaggcgctgcgcatcgtc
gaggagcgcgagccgcagatcgccgaggccatcgtcgccgagctcggcggcacccacctg
aaggccggcttcgagctgcacctggccaaggagttcctgcgcgaggccatccagctcgcc
ctgcgcccggccggccagatcctcccctccccgaccgagggcaaggagaaccgcgtctac
cgggtgcccgtcggggtcgtcggtgtcatcagccccttcaacttccccttcctgctctcc
ctgaagtccgtcgcccccgccctcgccctgggcaacgcggtcgtcctcaagccgcaccag
aacaccccgatctgcggcggcaccctgctggccaaggtcttcgaggacgccgggctcccc
gccggactgctcaacgtcgtcgtcaccgacatcgcggagatcggcgacaccctgctggag
caccccgtaccgcaggtcatctccttcaccggctcggacaaggtcggccggcatgtcgcg
acggtctgcgccgccaacctcaagcgcgccgtcctcgaactcggcggcaacagcgccctg
atcgtgctggacgacgccgatgtggactacgcggtcgacgcggcggtcttcagccgctac
gtccaccagggccaggtctgcatggctgccaaccggatcctggtcgaccgggcgatcgag
gaggagttcaccgagaagttcgtcgccaaggtcgcctccctcaccgtcggggacccggcc
gaccccgccacccagatcggcccgctgatcaactcctcgcaggccgagtccatctcccgg
ctcgtcgaccagaccgtcgaggccggtgccaccgccctgctccacggccgcgccgacggc
aacctggtcagcccctccgtcctgaccggcctcgcccccgactcgcccgtcctccagcag
gagatcttcggcccggtcgccctgctcgtccccttcgacggcgaggacgaggccgtccgc
atcgccaacgacaccccgtacgggctcagcggcgccgtccacaccgccaacatcgagcgc
ggcgtgcgggtcgggcagcgcatccacaccggcatgatccacatcaacgacggcaccgtc
cacgacgagccgatcgtccccttcggcggcgagaagagctcgggcctcggccggctgaac
ggcgagtcgatggtggaggccttcaccacgcagaagtggatctccgtccagcacggccgg
tcgcagttcccgttctga

DBGET integrated database retrieval system