KEGG   Streptomyces formicae: KY5_1763cHelp
Entry
KY5_1763c         CDS       T05416                                 

Definition
(GenBank) Ribulose-5-phosphate 4-epimerase-related epimerase and aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sfk  Streptomyces formicae
Pathway
sfk00051  Fructose and mannose metabolism
sfk01100  Metabolic pathways
sfk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KY5_1763c
Enzymes [BR:sfk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KY5_1763c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: ATL26781
UniProt: A0A291Q4W4
Position
complement(2146502..2147209)
Genome map
AA seq 235 aa AA seqDB search
MTEQRQDAGRDTAGEAGGAGRDAVEQAWAELVETARRTVREGLVVGTSGNVSVRVGGTVL
VTPSGVPYDRLTPGDALGVDLEGRQLFGDLSPTSELPMHLAIYRETDAGAVVHTHAVHAT
AVSMLVPELPAVHYMTGILGGPVRVAPYALYGTEELAENMLHALRDRTGCLLQNHGTVTY
GDSLSQAYDRTAQLEWMSRLWLTASSLPGHTPTLLSPDQLREAEERLRGYGQRRS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaacgacaggacgcggggcgggacacggcgggcgaagcgggcggcgcgggc
cgggacgccgtcgaacaggcgtgggccgagctggtggagaccgcccgcagaacggtgcgc
gagggcctggtcgtcggcacgtcgggcaacgtctccgtccgcgtcggcggcacggtcctg
gtcaccccgagcggcgtgccctacgaccggctgacgcccggggacgcgctcggcgtcgac
ctcgaagggcggcagctgttcggcgacctctcgcccaccagcgagctgcccatgcacctc
gcgatctaccgcgagaccgacgcgggggccgtcgtccacacccacgccgtgcacgccacg
gccgtctcgatgctcgtccccgaactccccgccgtccactacatgacgggcatcctcggc
gggcccgtccgggtcgctccgtacgccctgtacggaacggaggagctggccgagaacatg
ctgcacgccctgcgcgaccgcaccggatgcctcctccagaaccacggaacggtcacgtac
ggagactcgctgtcccaggcgtacgaccgcacggcccagctggaatggatgtcccgcctc
tggctcacggcgagctcgctgcccggccacacccccacactcttgtccccggaccagctc
cgtgaagcggaggagaggcttcgggggtacggacagcggcgttcctga

DBGET integrated database retrieval system