KEGG   Streptomyces formicae: KY5_3204cHelp
Entry
KY5_3204c         CDS       T05416                                 

Definition
(GenBank) N-acetylglucosamine-1-phosphate uridyltransferase / Glucosamine-1-phosphate N-acetyltransferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
sfk  Streptomyces formicae
Pathway
sfk00051  Fructose and mannose metabolism
sfk00520  Amino sugar and nucleotide sugar metabolism
sfk01100  Metabolic pathways
sfk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KY5_3204c
   00520 Amino sugar and nucleotide sugar metabolism
    KY5_3204c
Enzymes [BR:sfk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     KY5_3204c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep DUF4954 Fucokinase Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ATL28222
UniProt: A0A291Q9B9
Position
complement(3785131..3786213)
Genome map
AA seq 360 aa AA seqDB search
MTEAILLVGGKGTRLRPLTVNTPKPMVPAAGVPFLTHQLARARAAGVDHIVLATSYLAEV
FEPYFGDGSALGLHIEYVTEEEPLGTGGAIRNVASRLHSAPDEPVLIFNGDILTGLDIGA
LVRTHEESGADVSLHLTKVDDPRAFGLVPTDATGRVTAFLEKPGTPEEIVTDQINAGAYV
FRRSVIDTIPTGRPVSVERETFPGLLSSGAHLQGMVDSTYWLDLGTPQAFVRGSADLVLG
RAPSPAVPGRCGDSLVLPSASVAPDAKLTGGTVVGEGARIGEGARVTGSTILSGAVVGPG
AVITDSLIGEGARVGARAALSDAVIGDGAQVGADNELRDGARVWCDAVLPSGAVRFSSDQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaagcgatcctcctggtcggcggcaagggaacccggctgcgaccgctcacggtc
aacacccccaagccgatggtcccggcggcgggcgtcccgttcctcacccaccagctggcg
cgggcccgcgcggcgggcgtggaccacatcgtcctcgccacctcctacctcgccgaggtc
ttcgagccgtacttcggggacggctcggcgctcggcctccacatcgaatacgtgaccgag
gaagagcccctgggcacgggcggcgcgatccgcaacgtggcctcgcggctgcactcggcg
cccgacgagccggtcctgatcttcaacggggacatcctcacggggctggacatcggcgcc
ctggtccgtacccacgaggagtcgggcgcggacgtctccctgcacctcacgaaggtcgac
gacccgcgcgccttcggcctcgtccccaccgacgcgaccggcagggtcaccgccttcctg
gagaagccgggcacccccgaggagatcgtcaccgaccagatcaacgcgggcgcgtacgtg
ttccgccgctcggtcatcgacacgatccccacgggccgccccgtctcggtcgaacgcgag
accttccccggcctcctctcctccggcgcccacctccagggcatggtcgactcgacgtac
tggctggacctgggcaccccccaggcgttcgtacgcggctccgccgacctggtcctcggc
cgcgccccctccccggcggtccccggccgctgcggcgacagcctcgtcctgcccagcgcc
tccgtcgcccccgacgcgaagctcaccggcggcacggtggtcggcgagggcgcgcggatc
ggcgagggcgcgcgggtgaccggcagcacgatcctctccggcgcggtcgtcggacccggc
gccgtgatcacggactccctgatcggcgagggcgcccgcgtcggcgcccgagcggcactc
tccgacgcggtgatcggcgacggcgcgcaggtgggcgccgacaacgaactccgcgacggc
gcccgcgtctggtgcgacgcggtactgccgtccggcgcggtgaggttctcctcggaccag
tga

DBGET integrated database retrieval system