KEGG   Streptomyces formicae: KY5_3335cHelp
Entry
KY5_3335c         CDS       T05416                                 

Definition
(GenBank) Trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
sfk  Streptomyces formicae
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KY5_3335c
Enzymes [BR:sfk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     KY5_3335c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS Methyltransf_32 Metallophos_3 FtsJ Methyltransf_PK
Motif
Other DBs
NCBI-ProteinID: ATL28353
UniProt: A0A291QA42
Position
complement(3935671..3936489)
Genome map
AA seq 272 aa AA seqDB search
MSAAVWDPRQYLRHEGHRARPFVDLLARVPEPPDTGRAPRVADLGCGPGNVTRLLAERWP
AAHITGFDNSPQMLERAAGLAGPTEGGGRLDFAPADATDWAPAPGTYDLILSNATLQWVP
GHPDSFPAWVRALVPGGTLAFQVPGNFDAPSHVLMRELSESERWRGRLAGLLRHADAVLS
PGAYLERLAGLGCEVDAWETTYQHLLTGEDPVLDWVKGTGLRPVLTALADDAAATEEFLA
DYRELLRKAYPATAHGTVFPFRRVFAVARKGA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgctgccgtctgggatccccgtcagtacctgcgccacgagggccatcgcgcccgg
cccttcgtggacctgctcgcccgcgtccccgaaccgccggacaccggacgggcgccgcgc
gtcgccgacctcggctgcggccccggcaacgtcacccggctcctcgccgagcggtggccc
gccgcgcacatcaccgggttcgacaactccccgcagatgctggagcgggcggccgggctc
gcgggccccacggagggcgggggccgcctcgacttcgcacctgccgacgccacggactgg
gcgcccgcccccgggacgtacgacctgatcctctccaacgcgacgctccagtgggtcccg
ggtcacccggactccttccccgcctgggtccgcgcgctggtgcccggcggcacgctcgcc
ttccaggtgcccggcaacttcgacgcgcccagccacgtcctgatgcgggagctcagcgag
tccgagcggtggcgggggcggctcgccggactgctgcggcacgcggacgcggtgctgtcg
ccgggggcgtacctggagcggctcgcgggcctcggctgcgaggtcgacgcctgggagacg
acgtaccagcacctcctgaccggcgaggaccccgtcctcgactgggtcaagggcacgggc
ctgcgcccggtcctgaccgcgctcgcggacgacgcggcggcgacggaggagttcctcgcc
gactaccgcgagctgctgcgcaaggcgtacccggcgacggcccacggcacggtcttcccg
ttccggcgggtgttcgccgtggcgcgcaagggggcctga

DBGET integrated database retrieval system