KEGG   Streptomyces formicae: KY5_3813cHelp
Entry
KY5_3813c         CDS       T05416                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sfk  Streptomyces formicae
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    KY5_3813c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: ATL28831
UniProt: A0A291QAV2
Position
complement(4513183..4514181)
Genome map
AA seq 332 aa AA seqDB search
MDTFALIVTIGVALGFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFMGSG
VAKTVSEGIIETPHGDKGMWILFAALIGAIVWNLITWYFGLPSSSSHALFGGMVGAALAG
GIGVIWSGVVDKIVIPMFLSPVVGLVAGYLVMCAIMWMFRKSNPHKAKRGFRIAQTVSAA
GMALGHGLQDAQKTMGIVVMALVISDVQSADAPIPIWVKIACALMLSAGTYAGGWRIMRT
LGRKIIELDPPQGFAAETTGAGIMFTTAFMFHAPISTTHVITSAIMGVGATKRVNAVRWG
VAKNIILGWFITMPAAALVAAVSFWIVNLAFL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacacctttgcactgatcgtgaccatcggcgtcgcgctcggatttacgtatacgaat
ggctttcacgactccgcgaacgccatcgccacatccgtctccacgcgtgcgctgacgccg
cgcgccgcgctcgccatggccgcggtgatgaacctcgccggtgccttcatgggcagcggg
gtcgcgaagaccgtcagcgaggggatcatcgagaccccgcacggtgacaaggggatgtgg
atcctcttcgccgcgctcatcggcgcgatcgtgtggaacctgatcacctggtacttcgga
ctgccctcctcctcgtcgcacgcgctgttcggcggcatggtcggcgcggcgctcgcgggc
ggcatcggggtcatctggtccggggtcgtcgacaagatcgtcatcccgatgttcctctcc
ccggtggtcggcctcgtcgccggttacctggtgatgtgcgcgatcatgtggatgttccgc
aagtccaacccgcacaaggccaagcgcggtttccgcatcgcgcagacggtctccgcggcg
ggcatggccctcgggcacggtctccaggacgcgcagaagacgatgggcatcgtggtgatg
gcgctcgtcatctccgatgtgcagagcgcggatgcccccatcccgatctgggtcaagatc
gcctgtgcgctgatgctctccgccggtacgtacgcgggtggctggcgcatcatgcggacg
ctcggccggaagatcatcgagctggacccgccgcagggcttcgccgccgagacgaccggt
gcgggcatcatgttcaccacggcgttcatgttccacgcgccgatctcgacgactcacgtc
atcacgtccgcgatcatgggtgtgggggcgacgaagcgggtcaacgcggtgcggtggggt
gttgccaagaacatcatcttggggtggttcatcacgatgcctgcggcggcgctggtcgcc
gccgtgagtttctggatcgtcaacctcgccttcttgtag

DBGET integrated database retrieval system