KEGG   Streptomyces formicae: KY5_4064Help
Entry
KY5_4064          CDS       T05416                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
sfk  Streptomyces formicae
Pathway
sfk00030  Pentose phosphate pathway
sfk00480  Glutathione metabolism
sfk01100  Metabolic pathways
sfk01110  Biosynthesis of secondary metabolites
sfk01120  Microbial metabolism in diverse environments
sfk01130  Biosynthesis of antibiotics
sfk01200  Carbon metabolism
Module
sfk_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sfk_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KY5_4064
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KY5_4064
Enzymes [BR:sfk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     KY5_4064
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     KY5_4064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD 2-Hacid_dh_C F420_oxidored Minor_capsid_1 NAD_binding_11 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ATL29082
UniProt: A0A291QBT1
Position
4803649..4804524
Genome map
AA seq 291 aa AA seqDB search
MELGLVGLGKMGGNMRERIRRAGHTVIGYDRNPDLADVASLEELVGKLKGPRVVWVMVPA
GAATQSTIDELSELLQPGDVVVDGGNSRWTDDEKHAEELKAKGIGFVDCGVSGGVWGLEN
GYALMYGGDKENVAKVQPIFDALKPEGDFGSVHAGKVGAGHFAKMVHNGIEYAMMQAYAE
GWELLEKVDSVTDVREVFRSWQEGTVIRSWLLDLAVNALDDDEHLTDLRGYAQDSGEGRW
TVEAAIDNAVPLPAITASLFARFASRQDDSPQMKMIAALRNQFGGHAVEKK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggagctcggtctcgtcggcctcggcaagatgggcggcaacatgcgcgagcgcatccgc
cgcgcaggtcacaccgtcatcggatacgaccgcaatccggatctcgcggatgtcgcaagt
ctcgaagagctggtgggcaagctcaagggcccgcgggtggtgtgggtgatggtcccggcg
ggcgccgcgacccagtccaccatcgacgagctgtccgagctcctgcagcccggcgacgtc
gtcgtggacggcggcaactcccgctggaccgacgacgagaagcacgcggaggagctgaag
gccaagggcatcggcttcgtcgactgcggcgtctccggcggcgtctggggcctggagaac
ggctacgcgctgatgtacggcggcgacaaggagaacgtcgccaaggtgcagccgatcttc
gacgcgctcaagcccgagggtgacttcggctccgtgcacgcgggcaaggtcggtgcgggc
cacttcgcgaagatggtccacaacggcatcgagtacgcgatgatgcaggcctacgccgag
ggctgggagctcctggagaaggtcgactcggtcacggacgtccgtgaggtcttccgctcc
tggcaggagggcacggtcatccgttcctggctgctcgacctcgcggtcaacgccctggac
gacgacgagcacctgacggacctgcgcggctacgcacaggactccggagagggccgctgg
accgtcgaggcggccatcgacaacgccgtgccgctgcccgccatcaccgcctcgctcttc
gcgcgcttcgcgtcccggcaggacgactcgccgcagatgaagatgatcgccgcgctgcgc
aaccagttcggtggccacgcggtggagaagaagtag

DBGET integrated database retrieval system