KEGG   Streptomyces formicae: KY5_4800Help
Entry
KY5_4800          CDS       T05416                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
sfk  Streptomyces formicae
Pathway
sfk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    KY5_4800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sfk03011]
    KY5_4800
Ribosome [BR:sfk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    KY5_4800
  Bacteria
    KY5_4800
  Archaea
    KY5_4800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ATL29818
UniProt: A0A291QE21
Position
5600357..5600704
Genome map
AA seq 115 aa AA seqDB search
MEARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAH
NYDHSDASSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVSSKEGTR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagggcccaggcgcggtacatccgcgtcacgcccatgaaggcccgccgcgtg
gtggacctcatccgtggcatggatgccacggaggctcaggcggtcctgcgtttcgccccg
caggccgcgagcgtgccggtcggcaaggtgctggacagcgccattgccaacgccgcgcac
aactacgaccactctgacgcctcttcgctggtcatcagcgaggcgtacgtggatgagggc
ccgaccctgaagcggttccgtccgcgtgcccagggccgtgcctaccggatccgtaagcgg
accagccacatcaccgtggtcgtcagcagcaaggaaggaacccggtaa

DBGET integrated database retrieval system