KEGG   Streptomyces formicae: KY5_5173cHelp
Entry
KY5_5173c         CDS       T05416                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase, GlpX type
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
sfk  Streptomyces formicae
Pathway
sfk00010  Glycolysis / Gluconeogenesis
sfk00030  Pentose phosphate pathway
sfk00051  Fructose and mannose metabolism
sfk00680  Methane metabolism
sfk01100  Metabolic pathways
sfk01110  Biosynthesis of secondary metabolites
sfk01120  Microbial metabolism in diverse environments
sfk01130  Biosynthesis of antibiotics
sfk01200  Carbon metabolism
Module
sfk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KY5_5173c
   00030 Pentose phosphate pathway
    KY5_5173c
   00051 Fructose and mannose metabolism
    KY5_5173c
  09102 Energy metabolism
   00680 Methane metabolism
    KY5_5173c
Enzymes [BR:sfk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     KY5_5173c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX KH_1
Motif
Other DBs
NCBI-ProteinID: ATL30191
UniProt: A0A291QEP9
Position
complement(5981283..5982314)
Genome map
AA seq 343 aa AA seqDB search
MTEHHLPSELEVSPEAPDRNLALELVRVTEAAAMAAGRWVGRGDKNGADGAAVRAMRTLV
STVSMNGVVVIGEGEKDEAPMLFNGEHIGDGTGAEVDIAVDPIDGTTLTAKGQPNAIAVL
AAADRGAMFDPSAVFYMDKLVTGPEAADYVDINAPASVNIRRVAKAKNSSPEDVTVMILD
RPRHEGIVKEIRETGARIKFISDGDVAGSVMAVREGTGVDLLMGIGGTPEGIISACAIKC
LGGVIQGKLWPQDDAERQRAIDAGHDLDRTLSTDDLVRGDNVFFVATGITDGELLQGVRY
RAANASTSSLVMRSKSGTIRKIDSDHRLSKLRAYSAIDFDRAK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcatcatctcccctccgagctcgaggtttctcccgaggctcccgaccgcaac
ctcgccctcgagctggtccgggtcaccgaggcggccgccatggccgcgggccgctgggtc
ggccgcggcgacaagaacggcgccgacggcgccgccgtccgggccatgcggaccctcgtc
tccaccgtctcgatgaacggcgtcgtcgtcatcggcgagggcgagaaggacgaagccccg
atgctcttcaacggggagcacatcggcgacggcaccggcgccgaggtcgacatcgccgtc
gacccgatcgacggcaccacgctgaccgcgaagggccagccgaacgccatcgccgtgctc
gccgccgccgaccgcggcgccatgttcgacccgtcggccgtcttctacatggacaagctg
gtcacgggccccgaggccgcggactacgtcgacatcaacgcgcccgcttcggtcaacatc
cgccgcgtcgccaaggccaagaactcctcgcccgaggacgtcacggtcatgatcctggac
cgcccccggcacgagggcatcgtcaaggagatccgcgagaccggtgcccgcatcaagttc
atctcggacggcgacgtcgcgggttcggtcatggccgtccgcgagggcaccggcgtcgac
ctgctcatgggcatcggcggcacccccgagggcatcatctcggcctgtgcgatcaagtgc
ctcggcggtgtgatccagggcaagctgtggccgcaggacgacgccgagcgccagcgcgcc
atcgacgcgggccacgacctggaccgcacgctctccacggacgacctcgtccgcggggac
aacgtcttcttcgtcgcgaccggcatcaccgacggcgagctgctccagggcgtgcgctac
cgcgcggcgaacgcgtcgacgtcctcgctggtcatgcgctccaagtcgggcacgatccgc
aagatcgactccgatcaccggctgtcgaagctgcgcgcgtacagcgcgatcgacttcgac
cgcgccaagtag

DBGET integrated database retrieval system