KEGG   Streptomyces formicae: KY5_6603cHelp
Entry
KY5_6603c         CDS       T05416                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sfk  Streptomyces formicae
Pathway
sfk00620  Pyruvate metabolism
sfk00630  Glyoxylate and dicarboxylate metabolism
sfk01100  Metabolic pathways
sfk01110  Biosynthesis of secondary metabolites
sfk01120  Microbial metabolism in diverse environments
sfk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KY5_6603c
   00630 Glyoxylate and dicarboxylate metabolism
    KY5_6603c
Enzymes [BR:sfk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KY5_6603c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ATL31621
UniProt: A0A291QIT9
Position
complement(7700421..7702040)
Genome map
AA seq 539 aa AA seqDB search
MSALAPSPLAIVDAEPLPRQEEVLTDAALAFVAELHRLFTPRRDELLARRAERRAEIART
STLDFLPETAAIRADDSWRVAPAPAALNDRRVEITGPTDRKMTINALNSGAKVWLADFED
ASAPTWENVVLGQLNLADAYERRIDFTDERTGKSYALKEGGELATVVMRPRGWHLDERHL
QLDGQPVPGALVDFGLYFFHNAKRLIELGKGPYFYLPKTESYLEARLWNDIFVFAQDYVG
IPQGTVRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDGGSKFVLP
DRNLVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDAEVNKVAFEKVRADKDR
EAGDGFDGSWVAHPDLVPIAMESFDAVLGEKPNQKDRLREDVNVAPGDLIAIDSLDAKPT
YDGLVNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAGVVFENGETA
TADLARKVAAEELTAIRTEIGDEAFTTGKWQQAHDLLLQVSLDADYADFLTLPAYEQLR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcactagcgccgtcgccgctggccatcgtcgacgcagagcccctgccccggcag
gaggaggtgctcaccgacgcggccctcgcctttgtggccgagctgcaccggctgttcacg
ccccggcgtgacgagctcctcgcccgccgcgccgagcgccgtgcggagatcgcccgcacg
tcgaccctcgacttcctgccggagacggccgcgatccgcgcggacgactcgtggcgggtc
gccccggcgcccgccgcgctgaacgaccgccgcgtggagatcacgggcccgaccgaccgc
aagatgaccatcaacgccctgaactcgggcgccaaggtctggctcgccgacttcgaggac
gcctccgcgcccacctgggagaacgtggtcctcggtcagctcaacctcgccgacgcctac
gagcgccgcatcgacttcacggacgagcgcaccggcaagtcgtacgccctgaaggagggt
ggcgagctcgccaccgtcgtgatgcgcccgcgcggctggcacctggacgagcgccacctg
cagctcgacggccagcccgtccccggcgcgctcgtcgacttcggcctgtacttcttccac
aacgccaagcgcctcatcgagctcggcaagggcccgtacttctacctcccgaagacggag
tcgtacctggaggcgcgcctctggaacgacatcttcgtcttcgcgcaggactacgtcggc
atcccgcagggcaccgtccgcgccacggtcctcatcgagacgatcacggccgcgtacgag
atggaggagatcctctacgagctgcgcgatcacgcctcgggcctgaacgcgggccgctgg
gactacctcttctccatcgtcaagaacttccgtgacggcggctcgaagttcgtcctgccg
gaccgcaacctggtcacgatgaccgcccccttcatgcgggcgtacaccgaactcctcgtc
cgcacctgccacaagcgcggcgcgcacgcgatcggcggcatggccgcgttcatcccgtcg
cggcgggacgccgaggtcaacaaggtggcgttcgagaaggtccgcgccgacaaggaccgc
gaggcgggcgacggcttcgacggctcctgggtcgcgcacccggacctcgtcccgatcgcg
atggagtccttcgacgcggtcctgggcgagaagcccaaccagaaggaccgcctgcgcgag
gacgtcaacgtcgcccccggcgacctgatcgcgatcgactccctcgacgcgaagcccacc
tacgacggcctggtcaacgccgtccaggtcggcatccgctacatcgaggcctggctgcgc
ggcctcggcgccgtcgccatcttcaacctcatggaggacgcggccaccgccgagatctcg
cgctcgcagatctggcagtggatcaacgcgggcgtcgtcttcgagaacggcgaaacggcc
acggccgacctcgcccgcaaggtcgccgcagaggaactcaccgcgatccgcaccgagatc
ggcgacgaggccttcaccacaggcaagtggcagcaggcccacgacctcctcctccaggtc
tccctggacgcggactacgcggacttcctgaccctcccggcatacgagcaactgcgctga

DBGET integrated database retrieval system