KEGG   Shigella flexneri 301 (serotype 2a): SF0202
Entry
SF0202            CDS       T00097                                 

Gene name
safA
Definition
(RefSeq) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfl02044]
    SF0202 (safA)
Secretion system [BR:sfl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SF0202 (safA)
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-GeneID: 1027523
NCBI-ProteinID: NP_706157
UniProt: A0A2S4MSX4
Position
complement(230040..231086)
AA seq 348 aa
MEIFLSDPISAECPCGPDLEYDPEYLLLFTRAAPREEAQYGDFVSTPENINWAELERDAH
RLLMRSKDIRILVVLLRCRIQQAGARGLSEALTLLETLCSTYPDAIHPQLLATEDITAED
AAVARSNALAALLDHEGVMADIRGITLSNNAAMRLQVRDVERSLSALRPADALAPESVRQ
QLADLEARGTLPLDAFRQAAETTERLQRHARETLNDQAPDFSRLTQLLALLPGAVQSTTP
EILPQPQAEQPENATIVHTEQMQAEQIALPVHIAEEISPMTGAEPRQIRDRNDALERLRV
IRRWFEHSEPSSPTIPLLRQAERLVGKRVSEVINEIPVELLEKWDALE
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggaaatattcctgtctgacccaatttcggcggaatgcccctgcggcccggatctggag
tacgatccggaatacctgctgctgttcacccgcgccgcaccgcgtgaagaagcgcaatat
ggcgattttgtcagtacgccggaaaacattaactgggcggagcttgagcgggacgcccat
cgtctgctgatgcgcagcaaagatatccgcattctggttgtcctgctgcgctgccgtatc
cagcaggccggtgccaggggactgtcggaggcgctcacgctgctggaaacgttgtgctcc
acgtacccggacgccatccatcctcaactgctcgcgactgaagatatcaccgccgaagat
gctgcggtggcacgcagtaacgcgctggcggcgttgctggaccacgaaggtgtaatggcg
gatattcgtggcattacactgtcaaataatgctgccatgcgccttcaggtgcgggatgtg
gagcgttcgctatctgcattacgcccggcggatgcgctggcaccagaatcggtacgccag
caactggcagacctggaagcgcgcggcacactgccgctggatgcctttcgccaggcagca
gagaccactgagcggctgcaacgccatgcgcgtgaaacgctgaatgaccaggcaccggac
ttctcccgtctgacgcaactgctggccctgttaccgggagcagtgcagagcaccacgccg
gagatcctgccacaaccacaggctgagcagccggaaaacgccaccatcgttcatactgaa
cagatgcaggcagagcagattgcgctaccggtgcatatcgcggaggaaatatcaccgatg
accggcgcagaaccccggcagatccgcgaccgaaacgacgcgctggaacgcctgcgtgtc
atccgtcgctggtttgagcacagcgaaccgagcagcccgaccattcctttgctgcgccag
gcagaacgcctggtcggaaaacgcgtctcggaggtaataaatgaaattccagtagaactg
ctggagaaatgggatgcgctggagtaa

DBGET integrated database retrieval system