KEGG   Shigella flexneri 301 (serotype 2a): SF1265Help
Entry
SF1265            CDS       T00097                                 

Gene name
trpC
Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfl01100  Metabolic pathways
sfl01110  Biosynthesis of secondary metabolites
sfl01130  Biosynthesis of antibiotics
sfl01230  Biosynthesis of amino acids
Module
sfl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SF1265 (trpC)
Enzymes [BR:sfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SF1265 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SF1265 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-GeneID: 1024227
NCBI-ProteinID: NP_707171
UniProt: A0A0H2VV08 A0A226KA13
Position
complement(1314748..1316109)
Genome map
AA seq 453 aa AA seqDB search
MMQTVLAKIVADKAIWVETRKQQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASP
SKGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLLIVSQIAPQPILCKDFIID
PYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAK
VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSAL
MAHDDLHAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEV
MAAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEDQLYIDTLREALPAHVAIWKAL
SVGETLPAREFQHVDKYVLDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQT
GCAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaaacccgc
aaacagcagcaaccgctggccagttttcagaatgaggttcagccgagcacacgacatttt
tatgatgcgctacagggtgcacgcacggcgtttattctggagtgtaaaaaagcgtcgccg
tcaaaaggcgtgatccgtgatgatttcgatccggcacgcattgccgccatttataaacat
tacgcttcggcaatttcggtgctgactgatgagaaatattttcaggggagctttgatttc
ctcctcatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgac
ccttaccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttca
gtactggatgacgaccaatatcgccagcttgcagccgtcgctcacagtctggagatgggg
gtgctgaccgaagtcagtaatgaagaggaactggagcgcgccattgcattaggggcaaag
gtcgttggcatcaacaaccgcgatctgcgtgatttgtcgattgatctcaaccgtacccgc
gagcttgcgccgaaactggggcacaacgtaacggtaatcagcgaatccggcatcaatact
tacgctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttg
atggcccatgacgatttgcacgccgccgtgcgccgggtgttgctgggtgagaataaagta
tgtggcctgacgcgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggt
gggttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtg
atggctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtg
gtggacaaagctaaggtgttatcgctggcggcagtgcaactgcatggcaatgaagatcag
ctgtatatcgatacgctgcgtgaagctctgccagcacatgttgccatctggaaagcatta
agcgtcggtgaaaccctgcccgcccgcgagtttcagcacgttgataaatatgttttagac
aacggccagggtggaagcgggcaacgttttgactggtcactattaaatggtcaatcgctt
ggcaacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaacc
ggctgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgca
cgtcttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system