KEGG   Shigella flexneri 301 (serotype 2a): SF1827
Entry
SF1827            CDS       T00097                                 

Gene name
zntB
Definition
(RefSeq) zinc transporter
  KO
K16074  zinc transporter
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfl02000]
    SF1827 (zntB)
Transporters [BR:sfl02000]
 Other transporters
  Pores ion channels [TC:1]
   SF1827 (zntB)
SSDB
Motif
Pfam: CorA
Other DBs
NCBI-GeneID: 1024977
NCBI-ProteinID: NP_707685
UniProt: Q83KS5
Position
complement(1866091..1867074)
AA seq 327 aa
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP
LLPNNVRDALAGESTRPRVSRFGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR
QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ
IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE
IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ
FGFSIFCILLVVLIGGVALWLHRSKWL
NT seq 984 nt   +upstreamnt  +downstreamnt
gtggaagcgattaagggatcggacgttaatgtcccggatgcagtatttgcctggatgctg
gatggtagaggcggcgttaaaccgctggaaaatacagatgtgattgatgaagcgcatccc
tgctggctccaccttaattatgtacaccatgatagcgcccaatggctggcgacaacaccg
ctgcttcccaataacgtacgtgatgcgctggcgggcgagagcacacggccccgagtcagc
cgtttcggtgaaggcacgctgattacattgcgctgtataaacggcagcaccgatgaacgc
cccgatcaactggtcgccatgcgtgtatatatggacgggcggttaattgtttcgacccga
caacgcaaagtgctggcgctggacgatgtggtgagcgatctggaagagggcacgggtccg
accgattgcgggggatggctggtggatgtgtgcgatgcgttgaccgatcattccagtgaa
tttatcgagcagctgcacgataaaattatcgaccttgaagataatctccttgatcagcaa
attccaccgcgtggattcctggctctgctgcgcaaacaattaattgtgatgcgtcgctat
atggcaccgcaacgtgatgtttatgctcgtcttgccagtgaacgtttgccgtggatgagc
gatgaccaacgccgtcggatgcaggatattgccgatcgccttgggcgcggccttgacgaa
atcgacgcctgtatagcacggactggcgtgatggcggatgaaatcgctcaggtgatgcag
gaaaatttagctcgtcgtacctatacaatgtcgttgatggcaatggtctttttacccagt
acctttctgaccgggttatttggcgtcaaccttggtgggatccctggcggcgggtggcaa
ttcggattttcaattttttgtattctgttagttgttcttattggtggtgttgctttatgg
ttgcaccgtagtaaatggttgtaa

DBGET integrated database retrieval system