KEGG   Shigella flexneri 301 (serotype 2a): SF2179Help
Entry
SF2179            CDS       T00097                                 

Gene name
metG
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00450  Selenocompound metabolism
sfl00970  Aminoacyl-tRNA biosynthesis
sfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SF2179 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SF2179 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfl01007]
    SF2179 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sfl03016]
    SF2179 (metG)
Enzymes [BR:sfl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SF2179 (metG)
Amino acid related enzymes [BR:sfl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SF2179 (metG)
Transfer RNA biogenesis [BR:sfl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SF2179 (metG)
 Prokaryotic type
   Other AARSs
    SF2179 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-GeneID: 1025333
NCBI-ProteinID: NP_708001
UniProt: Q83KH0
Position
2201363..2203396
Genome map
AA seq 677 aa AA seqDB search
MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIM
LKAQQLGITPEQMIGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIEPKSVVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDSVSFDEYWKKDSTAELYHFIGKDIVY
FHSLFWPAMLEGSNFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLNHFDADSLRYYY
TAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFINKRFDGVLASELADPELYK
TFTDAAEVIGEAWESREFGKAVREIMALADLANRYVDEQAPWVVAKQEGRDADLQAICSM
GINLFRVLMTYLKPVLPKLTERAEAFLNTELTWDGIQQPLLGHKVNPFKALYNRIDMKQV
EALVEASKEEVKATTAPVTGPLADDPIQETITFDDFAKVDLRVALIENAEFVEGSDKLLR
LTLDLGGEKRNVFSGIRSAYPDPQALIGRHTIMVANLAPRKMRFGISEGMVMAAGPGGKD
IFLLSPDAGAKPGHQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaagaaaattctggtgacgtgcgcactgccgtacgctaacggctca
atccacctcggccatatgctggagcacatccaggctgatgtctgggtccgttaccagcga
atgcgcggccacgaggtcaacttcatctgcgccgacgatgcccacggtacaccgatcatg
ctgaaagctcagcagctcggtatcaccccggagcagatgattggcgaaatgagtcaggag
catcagactgatttcgcaggctttaacatcagctatgacaactatcactcgacgcacagc
gaagagaaccgccagttgtcagaacttatctactctcgcctgaaagaaaacggttttatt
aaaaaccgcaccatctctcagctgtacgatccggaaaaaggcatgttcctgccggaccgt
tttgtgaaaggcacctgcccgaaatgtaaatccccggatcaatacggcgataactgcgaa
gtctgcggcgcgacctacagcccgactgaattgatcgagccgaaatcggtggtttctggt
gctacaccagtgatgcgtgattctgaacacttcttctttgatctgccctctttcagcgaa
atgctgcaggcatggacccgcagcggtgcgttgcaggagcaggtggcaaacaaaatgcag
gagtggtttgaatccggcctgcaacagtgggatatctcccgcgacgcgccatactttggt
tttgaaattccgaacgcaccgggcaaatatttctacgtctggctggacgcaccgattggc
tacatgggttctttcaagaatctgtgcgacaagcgcggcgacagcgtaagcttcgatgaa
tactggaagaaagactccaccgccgagctgtaccacttcatcggtaaagatatcgtttac
ttccacagcctgttctggcctgccatgctggaaggcagcaacttccgcaagccgaccaac
ctgtttgttcatggctatgtgacggtgaacggcgcgaagatgtccaagtctcgcggcacc
tttattaaagccagcacctggctgaatcattttgacgctgacagcctgcgttactactac
actgcgaaactctcttcgcgcattgatgatatcgatctcaacctggaagatttcgttcag
cgtgtgaatgccgatatcgtgaacaaagtggttaacctggcctcccgtaatgcgggcttt
atcaacaagcgttttgacggtgtgctggcaagcgagctggctgaccctgagctgtacaaa
acctttaccgatgccgctgaagtgattggtgaagcgtgggaaagccgtgaatttggtaaa
gcagtgcgcgaaatcatggcactggctgacctggctaaccgctatgtcgacgagcaggct
ccgtgggtagtcgcaaaacaggaaggtcgcgatgctgacctgcaggcgatttgctcaatg
ggcatcaacctgttccgcgtgctgatgacttacctgaagcctgtactgccgaaactgacc
gagcgtgcagaagccttcctcaatacggaactgacctgggatggtatccagcaaccgctg
ctgggccacaaagtgaatccgttcaaggcgctgtataaccgcatcgatatgaaacaggtt
gaagctctggtggaagcctctaaagaagaagtgaaagccactaccgcgccagttactggc
ccactggcagatgatccgattcaggaaaccatcacctttgacgacttcgccaaagttgac
ctgcgcgtggcgctgatcgaaaacgcagagtttgttgaaggttctgacaaactgctgcgc
ctgacgctggatctcggcggtgaaaaacgcaatgtcttctccggtattcgttctgcttac
ccggatccgcaggcactgattggtcgtcacaccattatggtggctaacctggcaccacgt
aaaatgcgcttcggtatctctgaaggcatggtgatggctgccggtcctggcgggaaagat
attttcctgctaagcccggatgccggtgctaaaccgggtcatcaggtgaaataa

DBGET integrated database retrieval system