KEGG   Shigella flexneri 301 (serotype 2a): SF2336Help
Entry
SF2336            CDS       T00097                                 

Gene name
arnT
Definition
(RefSeq) 4-amino-4-deoxy-L-arabinose lipid A transferase
  KO
K07264  4-amino-4-deoxy-L-arabinose transferase [EC:2.4.2.43]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00540  Lipopolysaccharide biosynthesis
sfl01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SF2336 (arnT)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SF2336 (arnT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sfl01003]
    SF2336 (arnT)
   01005 Lipopolysaccharide biosynthesis proteins [BR:sfl01005]
    SF2336 (arnT)
Enzymes [BR:sfl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.43  lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase
     SF2336 (arnT)
Glycosyltransferases [BR:sfl01003]
 Polysaccharide
  Bacterial polysaccharide
   SF2336 (arnT)
Lipopolysaccharide biosynthesis proteins [BR:sfl01005]
 Lipid A
  SF2336 (arnT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_2
Motif
Other DBs
NCBI-GeneID: 1027765
NCBI-ProteinID: NP_708143
UniProt: Q83KB6
Position
2383636..2385288
Genome map
AA seq 550 aa AA seqDB search
MKSVRYLIGIFAFIACYYLLPISTRLLWQPDETRYAEISREMLASGDWIVPHLLGLRYFE
KPIAGYWINSIGQWLFGANNFGVRAGVIFATLLTAALVTWFTLRLWRDKRLALLATVIYL
SLFIVYAIGTYAVLDPFIAFWLVAGMCSFWLAMQAQTWKGKSAGFLLLGITCGMGVMTKG
FLALAVPVLSVLPWVATQKRWKDLFIYGWLAVISCVLTVLPWGLAIAQREPDFWHYFFWV
EHIQRFALDDAQHRAPFWYYVPVIIAGSLPWLGLLPGALYTGWKNRKHSATVYLLSWTIM
PLLFFSVAKGKLPTYILSCFAPLAMLLAHYALLAAKNNPLALRINGWINIAFGVTGIIAT
FVISPWGPMNTPVWQTFESYKVFCAWSIFSLWAFFGWYTLTNVEKTWSFAALCPLGLALL
VGFSIPDRVMEGKHPQFFVEMTQESLQPSRYILTDSVGVAAGLAWSLQRDDIIMYRQTGE
LKYGLNYPDAKGRFVSGDEFANWLNQHRQEGIITLVLSVDRDEDINSLAIPPADAIVRQE
RLVLIQYRPK
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggtacgttaccttatcggcatcttcgcgtttattgcctgctattacctgtta
ccgatcagcacgcgtctgctctggcaacccgatgaaacgcgttatgcggaaatcagtcga
gaaatgctggcatccggcgactggattgtgccccatctgttagggctacgttatttcgaa
aaacccattgccggatactggattaacagcattgggcaatggctatttggcgcgaataac
tttggtgtgcgggcaggcgttatctttgcgaccctgttaactgccgcgctggtgacctgg
tttactctgcgcttatggcgcgataaacgtctggctctactcgccacagtaatttatctc
tcattgtttattgtctatgccatcggcacttatgccgtgctcgatccgtttattgcattc
tggctggtggcgggaatgtgcagcttctggctggcaatgcaggcacagacgtggaaaggc
aaaagcgcaggatttttactgctgggaatcacctgcggcatgggggtgatgaccaaaggt
tttctcgcccttgccgtgccggtattaagcgtgctgccatgggtagcgacgcaaaaacgc
tggaaagatctctttatttacggctggctggcggttatcagttgcgtactgacggttctc
ccctggggactggcgatagcgcagcgggagcctgacttctggcactattttttctgggtt
gagcatattcaacgctttgcactagatgatgcccaacatagagctccgttctggtactac
gtgccggtcatcattgccggtagcctgccgtggctgggattactccccggtgcactgtac
acaggctggaaaaaccgcaagcattccgcaaccgtctatttgttgagctggacgataatg
ccgctgctgtttttctccgtcgctaaaggcaaattgcccacctatattctttcttgcttt
gcacctctggcaatgctgttggcgcattacgcgttgctggcagcaaaaaataatcctctg
gcgctgcggattaatggctggattaacatcgcttttggcgtcactggcattattgccaca
tttgtgatctccccctggggaccaatgaacacgccggtgtggcaaaccttcgagagctat
aaagtcttttgtgcctggtcgattttttcgctatgggcatttttcggctggtacacctta
acaaacgtcgaaaagacctggtctttcgccgcgctttgcccgctggggctggcgttgctg
gtaggattttcaattcctgacagagtcatggaaggaaaacatccgcaattttttgtcgag
atgacacaagaatcacttcagccaagccgctatattcttactgatagcgtcggtgttgcc
gcaggtctggcatggagcctgcaacgcgatgacatcatcatgtatcgccagacaggtgag
ttgaaatacggccttaattatccggatgcgaaagggagatttgtcagcggtgatgagttc
gcaaactggcttaatcaacatcgtcaggaggggattattacactcgtgctttcggttgac
cgcgatgaagatatcaacagtctcgccattccgcccgcagatgccatcgttcgtcaggag
cgtctggtgctgattcagtatcgtcccaaatga

DBGET integrated database retrieval system