KEGG   Shigella flexneri 301 (serotype 2a): SF2599Help
Entry
SF2599            CDS       T00097                                 

Gene name
hmpA
Definition
(RefSeq) bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2
  KO
K05916  nitric oxide dioxygenase [EC:1.14.12.17]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Brite
Enzymes [BR:sfl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.17  nitric oxide dioxygenase
     SF2599 (hmpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 Globin FAD_binding_6 Protoglobin DUF1987 BshC
Motif
Other DBs
NCBI-GeneID: 1026953
NCBI-ProteinID: NP_708389
UniProt: Q7C0F9
Position
2670705..2671895
Genome map
AA seq 396 aa AA seqDB search
MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQREALFNA
IAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFSPGQEVLDAW
GKAYGVLANVFINREAEIYNENASKAGGWEGTRDFRIVAKTPRSALITSFELEPVDGGAV
AEYRPGQYLGVWLKPEGFPHQEIRQYSLTRKPDGKGYRIAVKREEGGQVSNWLHNHANVG
DVVKLVAPAGDFFMAVADDTPVTLISTGVGQTPMLAMLDTLAKAGHTAQVNWFHAAENGE
VHAFADEVKELGQSLPRFTAHTWYRQPSEADRAKGQFDSEGLMDLSKLEGAFSDPTMQFY
LCGPVGFMQFTAKQLVDLGVKQENIHYECFGPHKVL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgctcaaaccatcgctacagtaaaagccaccatccctttactggtggaaacg
gggccaaagttaaccgcccatttctacgaccgtatgtttactcataacccagaactcaaa
gaaatttttaacatgagtaaccagcgtaatggcgatcaacgtgaagccctgtttaacgct
attgccgcctacgccagtaatattgaaaacctgcctgcgctgctgccagcggtagaaaaa
atcgcgcagaagcacaccagcttccagatcaaaccggaacagtacaacatcgtcggtgaa
cacctgttggcaacgctggacgaaatgttcagcccggggcaggaagtgctggacgcgtgg
ggtaaagcctatggtgtactggctaatgtatttatcaatcgcgaggcggaaatctataac
gaaaacgccagcaaagccggtggttgggaaggtactcgcgatttccgcattgtggctaaa
acaccgcgcagcgcgcttatcaccagcttcgaactggagccggtcgacggtggcgcagtg
gcagaataccgtccggggcaatatctcggcgtctggctgaagccggaaggtttcccgcat
caggaaattcgtcagtactctttgactcgcaaaccggatggcaaaggctatcgtatcgcg
gtgaaacgcgaagagggtgggcaggtatccaactggttgcacaatcacgccaatgttggc
gatgtcgtgaaactggtcgctccggcaggtgatttctttatggctgtcgcagatgacaca
ccagtgacgttaatctctaccggtgttggtcaaacgccaatgctggcaatgctcgacacg
ctggcaaaagcaggccacacagcacaagtgaactggttccatgcggcagaaaatggcgaa
gttcacgcctttgctgatgaagttaaggaactggggcagtcactgccgcgctttaccgcg
cacacctggtatcgtcagccgagcgaagccgatcgcgctaaaggtcagtttgatagcgaa
ggtctgatggatttgagcaaactggaaggtgcgttcagcgatccgacaatgcagttctat
ctctgcggcccggttggcttcatgcagtttaccgcgaaacagttagtggatctgggcgtg
aagcaggaaaacattcattacgaatgctttggcccgcataaggtgctgtaa

DBGET integrated database retrieval system