KEGG   Shigella flexneri 301 (serotype 2a): SF2854Help
Entry
SF2854            CDS       T00097                                 

Gene name
yqeF
Definition
(RefSeq) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00071  Fatty acid degradation
sfl00280  Valine, leucine and isoleucine degradation
sfl00310  Lysine degradation
sfl00362  Benzoate degradation
sfl00380  Tryptophan metabolism
sfl00620  Pyruvate metabolism
sfl00630  Glyoxylate and dicarboxylate metabolism
sfl00640  Propanoate metabolism
sfl00650  Butanoate metabolism
sfl00900  Terpenoid backbone biosynthesis
sfl01100  Metabolic pathways
sfl01110  Biosynthesis of secondary metabolites
sfl01120  Microbial metabolism in diverse environments
sfl01130  Biosynthesis of antibiotics
sfl01200  Carbon metabolism
sfl01212  Fatty acid metabolism
sfl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SF2854 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SF2854 (yqeF)
   00640 Propanoate metabolism
    SF2854 (yqeF)
   00650 Butanoate metabolism
    SF2854 (yqeF)
  Lipid metabolism
   00071 Fatty acid degradation
    SF2854 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SF2854 (yqeF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SF2854 (yqeF)
   00310 Lysine degradation
    SF2854 (yqeF)
   00380 Tryptophan metabolism
    SF2854 (yqeF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SF2854 (yqeF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SF2854 (yqeF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SF2854 (yqeF)
Enzymes [BR:sfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SF2854 (yqeF)
Exosome [BR:sfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SF2854 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-GeneID: 1025837
NCBI-ProteinID: NP_708633
UniProt: Q83JV6
Position
complement(2944771..2945952)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGEQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMIQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggtgcg
ttagcgggtcattccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtcttcctaacagcgtttct
gcaatcacgattaatgacgtttgcggttccggtcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgcaggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgaacagcttggcaatagccagttggtt
gacagtctggtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgatccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgaccgcggggaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaagggctggcaacgctttgtatcggc
gggggccagggcgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system